PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G20520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bHLH
Protein Properties Length: 100aa    MW: 10881.5 Da    PI: 7.3656
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G20520.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH28.33.1e-0923621554
                     HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
              HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                     ++ + +++L+ +lP++ ++ + K s ae+L++A++YI+ L
  ORUFI11G20520.1 23 QMAELISKLQAVLPTRGGEANAKASSAEVLQEACRYIRRL 62
                     78899**********88*********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508888.55862IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.09E-82278IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000104.1E-62362IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.5E-72365IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MSSSRRSRTS SRLAAAPPPT DEQMAELISK LQAVLPTRGG EANAKASSAE VLQEACRYIR  60
RLHREADALS ERLAELLLLQ PSDLAINGAD VPDLIRTLLM
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}.
UniProtAtypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8332021e-166CT833202.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA029D09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616701.19e-64transcription factor ILI2 isoform X2
SwissprotB8BLA32e-54ILI2_ORYSI; Transcription factor ILI2
SwissprotQ2R1J32e-54ILI2_ORYSJ; Transcription factor ILI2
TrEMBLA0A0E0RAN45e-63A0A0E0RAN4_ORYRU; Uncharacterized protein
STRINGORUFI11G20520.18e-64(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170041112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39860.18e-11bHLH family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]