PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G15720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 277aa    MW: 30334.2 Da    PI: 6.5818
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G15720.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM99.93.7e-31191419128
              NAM   9 PtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.....kg 97 
                      Pt+ +lvv+yL++++ ++++++ ++i++vdi++++Pwd+   ++++++  yfF++++++   ++++nra+ +g+W+  g++ ++++k     ++
  ORUFI11G15720.1  19 PTNADLVVHYLHRRAIQEPVPC-DFITNVDILQHNPWDIV-PAEEKTNGKYFFIHEENERLGNHHSNRAAGDGFWRPVGSEVPIYHKrsggaDE 110
                      9*********************.99**************5.455677899**********99************************98877777 PP

              NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                      +lvg+k+tLvf+ g+++++++t+Wvm+e+rl
  ORUFI11G15720.1 111 ALVGMKRTLVFHYGNSSSAKRTEWVMQEFRL 141
                      77***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100529.03111207IPR003441NAC domain
SuperFamilySSF1019411.29E-3018146IPR003441NAC domain
PfamPF023653.5E-1519141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MASPGVCINL VNGTSTRLPT NADLVVHYLH RRAIQEPVPC DFITNVDILQ HNPWDIVPAE  60
EKTNGKYFFI HEENERLGNH HSNRAAGDGF WRPVGSEVPI YHKRSGGADE ALVGMKRTLV  120
FHYGNSSSAK RTEWVMQEFR LAGATLIPCP VTRPATGDGS MLPCHRTGTT IATENNGSPS  180
AGQTHGPLEK TMVEPDSSLR ICRIYKKRQR TPQFIIPPSI GDARELILAL PTIGNTREVA  240
LALPAIDFLG QPSFEEGSDV SADVITDDKD GYGHGMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-171914123140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2420100.0AK242010.1 Oryza sativa Japonica Group cDNA, clone: J075106F03, full insert sequence.
GenBankEU8470010.0EU847001.1 Oryza sativa Japonica Group clone KCS322B05 NAM protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616648.10.0NAC transcription factor NAM-1
TrEMBLA0A0E0R8V20.0A0A0E0R8V2_ORYRU; Uncharacterized protein
TrEMBLQ2R3N40.0Q2R3N4_ORYSJ; NAM protein
STRINGORUFI11G15720.10.0(Oryza rufipogon)
STRINGOS11T0512100-010.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44822369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.17e-24NAC domain containing protein 52