PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G15710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 300aa    MW: 32983.5 Da    PI: 6.8377
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G15710.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM119.82.6e-37181481128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      l pGfrF+Ptd+elv +yL +++ + +l++  +i++vdi++++Pwd+   v+++ek  +fF++++ ky+ ++r+nr++ +g+W+a g++ +++ 
  ORUFI11G15710.1  18 LLPGFRFRPTDDELVIKYLYPRAFHVPLPC-AIITDVDIHHHNPWDIV-PVAEREKGKHFFTRKEVKYPGSRRSNRVAGNGFWRAAGSEVPIYY 109
                      579***************************.88**************5.567789999************************************ PP

              NAM  95 k.....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      k     ++ lvg+++tLvf+ g+++++e+t+W mhe++l
  ORUFI11G15710.1 110 KpegaaNDMLVGMRRTLVFHYGKSRSAERTEWAMHEFQL 148
                      9887777777***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-4112155IPR003441NAC domain
PROSITE profilePS5100539.16718217IPR003441NAC domain
PfamPF023651.3E-1920148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MANTGLSIPM VNGATIHLLP GFRFRPTDDE LVIKYLYPRA FHVPLPCAII TDVDIHHHNP  60
WDIVPVAERE KGKHFFTRKE VKYPGSRRSN RVAGNGFWRA AGSEVPIYYK PEGAANDMLV  120
GMRRTLVFHY GKSRSAERTE WAMHEFQLAG AGLLPHPMMR HATSNGSEPP CGCLEATIAK  180
KSDGLSATLR AKRDSAPLMR IMVEPDSSWV ICCIYKKRQR APPVVIPPVI GDVGEAIIPH  240
AIGDAREGQL HFIDFLGQPA RNDPSSPHSC TIDPSSLEEG SDESAGDGED KDGDGMNEAN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-281414811140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1073690.0AK107369.1 Oryza sativa Japonica Group cDNA clone:002-127-B02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615934.10.0NAC transcription factor 25
TrEMBLA0A0E0R8V10.0A0A0E0R8V1_ORYRU; Uncharacterized protein
TrEMBLQ2R3N50.0Q2R3N5_ORYSJ; No apical meristem protein, expressed
STRINGORUFI11G15710.10.0(Oryza rufipogon)
STRINGOS11T0512000-010.0(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44822369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-34NAC domain containing protein 83