PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G00360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 417aa    MW: 45856.2 Da    PI: 8.1829
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G00360.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.16.9e-392763697100
           DUF260   7 vlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                      +lrr+C+++Cv+apyfpae++++fa+vh++FGasnv+k+l ++p+ +r+da+sslvyeA+ar+rdPvyG+v+ i+ lq+q++ql+ +lal+++e
  ORUFI11G00360.1 276 LLRRRCTSECVFAPYFPAEEAQRFAMVHRVFGASNVSKMLLDVPPPQRPDAVSSLVYEANARMRDPVYGCVAAISFLQNQVSQLQMQLALAHAE 369
                      68***************************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.743269370IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-37276367IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MATAAAAGDG DEHLLSLFAS ALSHRRFGDQ ELSLLDAALS AGADVPSLLH TRSSTRCLLR  60
KAAAQAFSSV PDLGTTLSVA DFFARAFALT GNVESCLAMR YEALLLRQAK YSDDLHLQVS  120
NEEWLTFAKD SLDNGFYTIA SKAFANALLH IDPSHPGYLD STNSILKKDK INDISGLQNL  180
AKSLSARHSV QAQSAEYMKR KASGVDEKCN LHLGKTKLPG SLMFRLGIKT RNIQKLRCSR  240
EKEACTATAS NGGKRERERD TVRVVQAAAA AVHVGLLRRR CTSECVFAPY FPAEEAQRFA  300
MVHRVFGASN VSKMLLDVPP PQRPDAVSSL VYEANARMRD PVYGCVAAIS FLQNQVSQLQ  360
MQLALAHAET AALQLQLQQQ HQDQDDHHHQ QCILENAAAH HQLMLQEAFL KKESMWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-372673698110LOB family transfactor Ramosa2.1
5ly0_B1e-372673698110LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2417610.0AK241761.1 Oryza sativa Japonica Group cDNA, clone: J065205C18, full insert sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankBX0004940.0BX000494.2 Oryza sativa chromosome 12, . BAC OSJNBa0052H10 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0004970.0BX000497.1 Oryza sativa chromosome 11, . BAC OSJNBa0010K05 of library OSJNBa from chromosome 11 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617626.11e-174uncharacterized protein LOC4349559
TrEMBLA0A0E0R3500.0A0A0E0R350_ORYRU; Uncharacterized protein
STRINGORUFI11G00360.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP675133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-37LBD family protein