PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI10G17730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 321aa    MW: 35135.1 Da    PI: 4.9146
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI10G17730.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.61.2e-4981251122
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      +ppGfrFhPtdeelv +yL+kkv+++k++l +vi++vd+y++ePwdL+   ++e++ewyfFs +d+ky+tg+r+nrat +g+Wkatg+dk+v +
  ORUFI10G17730.1   8 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDVDLYRIEPWDLQ--GYEEQSEWYFFSYKDRKYPTGTRTNRATMTGFWKATGRDKAVRE 98 
                      69****************************.9***************8..345789*************************************9 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWv 122
                       +++l+g++ktLvfykgrap+g+ktdW+
  ORUFI10G17730.1  99 -RSRLIGMRKTLVFYKGRAPNGHKTDWI 125
                      .999***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.1E-504137IPR003441NAC domain
PROSITE profilePS5100547.7928158IPR003441NAC domain
PfamPF023654.2E-239125IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MVIMESCVPP GFRFHPTDEE LVGYYLRKKV ASQKIDLDVI RDVDLYRIEP WDLQGYEEQS  60
EWYFFSYKDR KYPTGTRTNR ATMTGFWKAT GRDKAVRERS RLIGMRKTLV FYKGRAPNGH  120
KTDWIEEGWV VCRAFKKRTM QPPRSSIGAW EASYSYHDPA VFVGGGEHFK QEAAAELDGV  180
AAAAGANAFL RYSTRLAELP QLESPPLPSQ GSQAASAVVD GEEDNADSSR RPGGGGGAAA  240
AVTTDWRAFD KFVASQLSPE EQHTCRATDD DDMAALLLLD GGGQEDDAGR WLGSAGLLSA  300
VAADATTDCG LGTSCVPGDI N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-43513912170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0923890.0AC092389.4 Oryza sativa chromosome 10 BAC OSJNBa0053C23 genomic sequence, complete sequence.
GenBankAC1139480.0AC113948.5 Oryza sativa chromosome 10 BAC OSJNBb0038A07 genomic sequence, complete sequence.
GenBankAK1063130.0AK106313.1 Oryza sativa Japonica Group cDNA clone:002-101-D07, full insert sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankJN6340730.0JN634073.1 Oryza sativa Japonica Group secondary wall NAC transcription factor 4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613865.10.0NAC domain-containing protein 105
SwissprotO655084e-96NAC76_ARATH; NAC domain-containing protein 76
TrEMBLA0A0E0IVF10.0A0A0E0IVF1_ORYNI; Uncharacterized protein
TrEMBLA0A0E0R1R50.0A0A0E0R1R5_ORYRU; Uncharacterized protein
STRINGORUFI10G17730.10.0(Oryza rufipogon)
STRINGONIVA10G18400.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36253768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.16e-85vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]