PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI10G00640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family BBR-BPC
Protein Properties Length: 341aa    MW: 37750 Da    PI: 10.2984
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI10G00640.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind410.52e-12513411301
        GAGA_bind   1 mdddgsre.rnkg.yyepaaslkenlglqlmssia.erdaki...........rernlalsekkaavaerd....................... 57 
                      mddd+s++ r +g ++e+    ++nlglqlmss++ erd+k+           +++++  +++++++++rd                       
  ORUFI10G00640.1   1 MDDDASMSiR-WGgFFESP---ARNLGLQLMSSVPaERDTKQllsgspflhhqHQQHV-PHHHHQPHHPRDcgangnanggamppppateapps 89 
                      9*******66.777***99...88**********99**************99656666.9********************************** PP

        GAGA_bind  58 ..maflqrdkalae..rnkalverdnkllalllvensla...salpvgvqvlsgtksidslqqlsepqledsave.lreeeklealpieeaaee 143
                        m+f+++d++++   +++++++r++k+l++l+v ++++   +++pvg+++++gt++++++qq++epql++++ + +++ee+++++ iee++++
  ORUFI10G00640.1  90 mpMNFARSDMWMHPqqQQQHHHPREHKALHNLTVGHGSShiaHHDPVGYGMIPGTHTLQMMQQQTEPQLQPPPPPqQPKEECISSPLIEENVPV 183
                      ************9754778999**************9988999****************************9999899**************** PP

        GAGA_bind 144 akekkkkkkrqrakkpkekkakkkkkksekskkkvkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCt 236
                      ++e + +kkrq++++pk+++akk+kk s++++++ ++++a+ +r++ ++k+i++v+ng++lD s++P+P+CsCtGa++qCY+WG+GGWqSaCCt
  ORUFI10G00640.1 184 IDEPPPPKKRQQGRQPKVPRAKKPKK-SAAPREDGAPPNAPaPRRRGPRKNIGMVINGIDLDLSRIPTPICSCTGAPQQCYRWGAGGWQSACCT 276
                      **************************.88999*******999**************************************************** PP

        GAGA_bind 237 ttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                      ttiS+yPLP+stkrrgaRiagrKmS+gafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  ORUFI10G00640.1 277 TTISTYPLPMSTKRRGARIAGRKMSHGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR 341
                      ****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.9E-1981341IPR010409GAGA-binding transcriptional activator
PfamPF062173.2E-1181341IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MDDDASMSIR WGGFFESPAR NLGLQLMSSV PAERDTKQLL SGSPFLHHQH QQHVPHHHHQ  60
PHHPRDCGAN GNANGGAMPP PPATEAPPSM PMNFARSDMW MHPQQQQQHH HPREHKALHN  120
LTVGHGSSHI AHHDPVGYGM IPGTHTLQMM QQQTEPQLQP PPPPQQPKEE CISSPLIEEN  180
VPVIDEPPPP KKRQQGRQPK VPRAKKPKKS AAPREDGAPP NAPAPRRRGP RKNIGMVING  240
IDLDLSRIPT PICSCTGAPQ QCYRWGAGGW QSACCTTTIS TYPLPMSTKR RGARIAGRKM  300
SHGAFKKVLE KLAGEGYNLN NPIDLKTFWA KHGTNKFVTI R
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1451270.0AC145127.1 Oryza sativa Japonica Group chromosome 10 clone Pseudo10p0.0-10p4.4, complete sequence.
GenBankAC0986940.0AC098694.3 Oryza sativa Japonica Group chromosome 10 clone OJ1014H12, complete sequence.
GenBankAC0788910.0AC078891.2 Oryza sativa Japonica Group chromosome 10 clone OSJNBa0092N12, complete sequence.
GenBankAY5690370.0AY569037.1 Oryza sativa (japonica cultivar-group) barley B recombinant like-protein B mRNA, complete cds.
GenBankAY5690360.0AY569036.1 Oryza sativa (japonica cultivar-group) barley B recombinant like-protein B gene, complete cds.
GenBankAY5690350.0AY569035.1 Oryza sativa (japonica cultivar-group) barley B recombinant like-protein A mRNA, complete cds.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankAK0636430.0AK063643.1 Oryza sativa Japonica Group cDNA clone:001-118-H02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612731.10.0PREDICTED: barley B recombinant-like protein A
RefseqXP_015612730.10.0PREDICTED: barley B recombinant-like protein A
RefseqXP_015612727.10.0PREDICTED: barley B recombinant-like protein A
RefseqXP_015612725.10.0PREDICTED: barley B recombinant-like protein A
SwissprotP0DH880.0BBRA_ORYSJ; Barley B recombinant-like protein A
SwissprotP0DH890.0BBRB_ORYSJ; Barley B recombinant-like protein B
TrEMBLA0A0E0QVN80.0A0A0E0QVN8_ORYRU; Uncharacterized protein
STRINGLOC_Os10g02584.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22113697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.32e-60basic pentacysteine 2