PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI09G20530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 599aa    MW: 67069.4 Da    PI: 5.4016
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI09G20530.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.85e-541162451128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhPtdeelv++yLk+k++g k+el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v
  ORUFI09G20530.1 116 LPPGFRFHPTDEELVNYYLKRKIHGLKIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRV 208
                      79****************************.99**************84335556888************************************ PP

              NAM  93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +g+++g+kktLv+y+grap+g++tdWvmheyrl
  ORUFI09G20530.1 209 VHQhGGRAIGMKKTLVYYRGRAPQGVRTDWVMHEYRL 245
                      99978899***************************98 PP

2NAM172.81e-533885151128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhPtdeelv++yLk+kv+g +++l ++i+evd+yk+ePw+L+ k  + ++++ewyfF +rd+ky++g r+nrat++gyWk+tgkd+++
  ORUFI09G20530.1 388 LPPGFRFHPTDEELVNYYLKRKVHGLSIDL-DIIPEVDLYKCEPWELEeKsFLPSKDSEWYFFGPRDRKYPNGCRTNRATRAGYWKSTGKDRRI 480
                      79****************************.99**************84345566899************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ +g+kktLv+ykgrap+g +t+Wvmheyr+
  ORUFI09G20530.1 481 NY-QNRSIGMKKTLVYYKGRAPQGIRTSWVMHEYRI 515
                      *9.8899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-64107268IPR003441NAC domain
PROSITE profilePS5100560.845116268IPR003441NAC domain
PfamPF023654.3E-29117245IPR003441NAC domain
SuperFamilySSF1019411.96E-62381538IPR003441NAC domain
PROSITE profilePS5100559.297388538IPR003441NAC domain
PfamPF023657.8E-29389515IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MEKVQASCEG DQGICKRGAK GGHPIDQNLV GGMTMSTGVP TTVPPTPALA ALKNLLIRVV  60
AAAAGKGLSS SAEEARCLWA KLPAPEEEEE AGQQPERPPS SYRRPPTSTL MAPVGLPPGF  120
RFHPTDEELV NYYLKRKIHG LKIELDIIPE VDLYKCEPWE LAEKSFLPSR DPEWYFFGPR  180
DRKYPNGFRT NRATRAGYWK STGKDRRVVH QHGGRAIGMK KTLVYYRGRA PQGVRTDWVM  240
HEYRLDDKDC EDTMPIKDTY ALCRVFKKNA ICTEVEELQG QCSMALLEGA CQQLLASGGG  300
GSQEQYETPS PPDVPVGSTS GGADADAEDD PDKDDSWMQF ISDDAWCSST ADGGAEESTS  360
CRIAGVGGLM PEARKEEANW EAMAPVGLPP GFRFHPTDEE LVNYYLKRKV HGLSIDLDII  420
PEVDLYKCEP WELEEKSFLP SKDSEWYFFG PRDRKYPNGC RTNRATRAGY WKSTGKDRRI  480
NYQNRSIGMK KTLVYYKGRA PQGIRTSWVM HEYRIEESEC ENAMGIQDSY ALCRIFKKNV  540
VLGEFDKKGE CSSSQAKGNE EQVTDFGDAG QSSGANENDK DNSWMQFIAE DLWCTNKLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5111153910167NO APICAL MERISTEM PROTEIN
1ut4_B2e-5111153910167NO APICAL MERISTEM PROTEIN
1ut7_A2e-5111153910167NO APICAL MERISTEM PROTEIN
1ut7_B2e-5111153910167NO APICAL MERISTEM PROTEIN
3swm_A2e-5111153913170NAC domain-containing protein 19
3swm_B2e-5111153913170NAC domain-containing protein 19
3swm_C2e-5111153913170NAC domain-containing protein 19
3swm_D2e-5111153913170NAC domain-containing protein 19
3swp_A2e-5111153913170NAC domain-containing protein 19
3swp_B2e-5111153913170NAC domain-containing protein 19
3swp_C2e-5111153913170NAC domain-containing protein 19
3swp_D2e-5111153913170NAC domain-containing protein 19
4dul_A2e-5111153910167NAC domain-containing protein 19
4dul_B2e-5111153910167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1375960.0AC137596.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 9 clone OSJNBb0031H05, complete sequence.
GenBankAP0055640.0AP005564.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1228_C03, complete sequence.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612702.20.0NAC domain-containing protein 86
SwissprotQ9FFI56e-84NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0E0QUU90.0A0A0E0QUU9_ORYRU; Uncharacterized protein
STRINGORUFI09G20530.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-109NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]