PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI09G18130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 279aa    MW: 29271.1 Da    PI: 8.8581
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI09G18130.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP104.51.7e-32122211595
              TCP   5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaa 95 
                        r+ ++h kv+gR+RR+R++++caar+ +L++eLG+++d++ti WL+qq++pai ++tgt++ +a ++ +++ +    ++s ++aa+ ++
  ORUFI09G18130.1 122 PPRNRDRHVKVEGRGRRIRMPVNCAARIAQLTRELGHKSDGETIRWLMQQSEPAIVAATGTGTVPAIAT-TVDGVLRIPTESPSAAARGDE 211
                      5799*********************************************************99988444.444444444333333333222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136925.128125179IPR017887Transcription factor TCP subgroup
PfamPF036342.2E-26125209IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MASQLQGKGA ETAAAGERVA PGTNAAAFAG LGYPPIQSPV ALQEEEGPRD AAFAGYAPIR  60
SPVVSRLQEK GEGEGEEEEV DKREEAGMAA DGSAFAAGMA LVPKPEPVAV EFLRGLAVAK  120
PPPRNRDRHV KVEGRGRRIR MPVNCAARIA QLTRELGHKS DGETIRWLMQ QSEPAIVAAT  180
GTGTVPAIAT TVDGVLRIPT ESPSAAARGD EPAPKRRRKL QPTRAAAGGP VEALAAAPPP  240
AESINKTSLP YRSSWHELNS AFPHPHSCPK SCFGGLPPR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213219PKRRRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061750.0AP006175.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0669G04.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612634.11e-165transcription factor PCF2-like
TrEMBLA0A0E0QU000.0A0A0E0QU00_ORYRU; Uncharacterized protein
STRINGORUFI09G18130.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.12e-42TCP family protein