PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI09G17730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 238aa    MW: 26200.8 Da    PI: 10.5213
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI09G17730.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.16.1e-114199563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                     kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+   + l++e+
  ORUFI09G17730.1 41 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLALLQRDTSGLTTEN 99
                     9**********************************************999988888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-1637101IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.89839102IPR004827Basic-leucine zipper domain
PfamPF001701.4E-94199IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.9E-114196No hitNo description
SuperFamilySSF579595.42E-114192No hitNo description
CDDcd147034.70E-204291No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MSIKAEELVG ASPGTEGMSS AEAKKAVSAA KLAELALVDP KRAKRIWANR QSAARSKERK  60
MRYIAELERK VQTLQTEATT LSAQLALLQR DTSGLTTENS ELKLRLQTME QQVHLQDALN  120
DTLKSEVQRL KVATGQMANG GGMMMNFGGM PHQFGGNQQM FQNNQAMQSM LAAHQLQQLQ  180
LHPQAQQQQV LHPQHQQQQP LHPLQAQQLQ QAARDLKMKS PMGGQSQWGD GKSGSSGN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0054920.0AF005492.1 Oryza sativa bZIP transcriptional activator RF2a (rf2a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612692.11e-169PREDICTED: transcription factor RF2a
SwissprotQ69IL41e-171RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A0D3H8X81e-169A0A0D3H8X8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0QTU81e-171A0A0E0QTU8_ORYRU; Uncharacterized protein
TrEMBLA2Z3421e-169A2Z342_ORYSI; Putative uncharacterized protein
TrEMBLI1QQF91e-169I1QQF9_ORYGL; Uncharacterized protein
STRINGBGIOSGA029440-PA1e-169(Oryza sativa Indica Group)
STRINGLOC_Os09g34060.11e-169(Oryza sativa Japonica Group)
STRINGORGLA09G0128800.11e-169(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.17e-41bZIP family protein