PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI09G16430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 351aa    MW: 39001.6 Da    PI: 9.5506
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI09G16430.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.77.7e-56211511128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL++k+++  +++ ++i+evd++k+ePwdLp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+++
  ORUFI09G16430.1  21 LPPGFRFHPTDEELITYYLRQKIADGGFTA-RAIAEVDLNKCEPWDLPEKAKMGEKEWYFFSLRDRKYPTGVRTNRATNAGYWKTTGKDKEIFT 113
                      79*************************999.89***************99999****************************************9 PP

              NAM  95 k....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                           + elvg+kktLvfykgrap+gekt+Wvmheyrl
  ORUFI09G16430.1 114 GqppaTPELVGMKKTLVFYKGRAPRGEKTNWVMHEYRL 151
                      766666677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-6417172IPR003441NAC domain
PROSITE profilePS5100560.86321172IPR003441NAC domain
PfamPF023652.3E-2922151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MAMGMEGSGG GGSAKKKEES LPPGFRFHPT DEELITYYLR QKIADGGFTA RAIAEVDLNK  60
CEPWDLPEKA KMGEKEWYFF SLRDRKYPTG VRTNRATNAG YWKTTGKDKE IFTGQPPATP  120
ELVGMKKTLV FYKGRAPRGE KTNWVMHEYR LHSKSIPKSN KDEWVVCRIF AKTAGVKKYP  180
SNNAHSRSHH PYTLDMVPPL LPALLQQDPF GRGHHPYMNP VDMAELSRFA RGTPGLHPHI  240
QPHPSYINPA APFTLSGLNL NLGSSPAMPP PPPPPPQSIL QAMSMPMNQP STTNQVMVTE  300
QMIPGLANGV IPQGTDGGFT TDVVVGGTGI RYQNLDVEQL VERYWPGSYQ M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-552017816171NO APICAL MERISTEM PROTEIN
1ut4_B1e-552017816171NO APICAL MERISTEM PROTEIN
1ut7_A1e-552017816171NO APICAL MERISTEM PROTEIN
1ut7_B1e-552017816171NO APICAL MERISTEM PROTEIN
4dul_A1e-552017816171NAC domain-containing protein 19
4dul_B1e-552017816171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1025110.0AK102511.1 Oryza sativa Japonica Group cDNA clone:J033095I08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612624.10.0NAC domain-containing protein 92
RefseqXP_015612625.10.0NAC domain-containing protein 92
SwissprotQ9FLJ22e-82NC100_ARATH; NAC domain-containing protein 100
SwissprotQ9FLR31e-82NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A0E0QTA00.0A0A0E0QTA0_ORYRU; Uncharacterized protein
STRINGORUFI09G16430.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP93613846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.24e-90NAC domain containing protein 38
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vidal EA,Álvarez JM,Gutiérrez RA
    Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function.
    Plant Signal Behav, 2014. 9(3): p. e28501
    [PMID:24642706]
  4. Lee MH,Jeon HS,Kim HG,Park OK
    An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164.
    New Phytol., 2017. 214(1): p. 343-360
    [PMID:28032643]