PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI09G00870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 208aa    MW: 22950.3 Da    PI: 10.7864
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI09G00870.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.31.5e-212269249
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     rie++  rqv fskRr+g +KKA+ELS+LC a+va ++fs+ gk y +
  ORUFI09G00870.1 22 RIESEEARQVCFSKRRAGFFKKASELSILCSADVAAVVFSPAGKAYSF 69
                     8*******************************************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-301372IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.89E-271386IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.1561373IPR002100Transcription factor, MADS-box
CDDcd002657.01E-381485No hitNo description
PRINTSPR004043.3E-201535IPR002100Transcription factor, MADS-box
PfamPF003193.2E-252269IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-203550IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-205071IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009559Biological Processembryo sac central cell differentiation
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MVTAAAARRR PSLGRQKIEI RRIESEEARQ VCFSKRRAGF FKKASELSIL CSADVAAVVF  60
SPAGKAYSFG HPSVEFLLDR FLSSSLPATA GKEEGSSVSV VAELNRQYGE LRAMVDAHKA  120
RRERAEKTME KQRQRQPAAW MDPEAEVGRM APEELMALGT KLVAVQGGVA ARADQMLRDA  180
LLLGRRPNTT TTTTTRAPPG FFHLHPHF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057890.0AP005789.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0563F09.
GenBankAP0058840.0AP005884.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0598D02.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611069.11e-151agamous-like MADS-box protein AGL29
TrEMBLA0A0E0IGA71e-149A0A0E0IGA7_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QMX11e-149A0A0E0QMX1_ORYRU; Uncharacterized protein
TrEMBLB8BCY81e-149B8BCY8_ORYSI; Uncharacterized protein
TrEMBLQ6YTZ91e-149Q6YTZ9_ORYSJ; MADS-box protein-like
STRINGORUFI09G00870.11e-150(Oryza rufipogon)
STRINGOS09T0116800-001e-150(Oryza sativa)
STRINGONIVA09G00960.11e-150(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.16e-26AGAMOUS-like 61