PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI09G00820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 178aa    MW: 19332.1 Da    PI: 4.5524
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI09G00820.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF37.82.5e-12242444
                     -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
           SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                     e++  r+v fskRr+ ++K A+ELSv  +a+va ++fs+ g
  ORUFI09G00820.1  2 ESEEARKVCFSKRRADLFKMASELSVHFNADVAAVVFSPAG 42
                     78889**********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.904142IPR002100Transcription factor, MADS-box
SMARTSM004324.1E-4151IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.8E-14262IPR002100Transcription factor, MADS-box
PfamPF003193.4E-17243IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MESEEARKVC FSKRRADLFK MASELSVHFN ADVAAVVFSP AGNRAYSIGD PSVMDRFLSS  60
LPAPAPPAET EPEPEVDWSV MEELSRQCGQ LQAMVEAHKA RLEKAEEKLR ESGAAAWMMD  120
LEAEVGRMAP EDVLALVTKL AVLRDGVAER AHEMLREALL AVAAPTPTTP TTPPPAGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057890.0AP005789.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0563F09.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611505.11e-123agamous-like MADS-box protein AGL29
TrEMBLA0A0E0QMW51e-124A0A0E0QMW5_ORYRU; Uncharacterized protein
STRINGORUFI09G00820.11e-125(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2026177
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.13e-14AGAMOUS-like 29