PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G26250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 665aa    MW: 72981.8 Da    PI: 4.3324
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G26250.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.94.1e-53211481128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      l+pGfrFhPtdeelv++yLk+kv+g++l++ ++i+evd+ykvePwdLp+  ++++++++wyfFs+ d+k+a+  r+nrat+ gyWk+tgkd+ev
  ORUFI08G26250.1  21 LAPGFRFHPTDEELVSYYLKRKVHGRPLKV-DAIAEVDLYKVEPWDLPArsRLRSRDSQWYFFSRLDRKHANRARTNRATAGGYWKTTGKDREV 113
                      579***************************.99***************4357888999************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + + ++vg+kktLvf+ grapkge+t+Wvmheyrl
  ORUFI08G26250.1 114 RN-GPTTVGMKKTLVFHAGRAPKGERTNWVMHEYRL 148
                      *9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6014168IPR003441NAC domain
PROSITE profilePS5100558.61221168IPR003441NAC domain
PfamPF023656.9E-2923148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 665 aa     Download sequence    Send to blast
MSHPSSSSSS APPAAAEATS LAPGFRFHPT DEELVSYYLK RKVHGRPLKV DAIAEVDLYK  60
VEPWDLPARS RLRSRDSQWY FFSRLDRKHA NRARTNRATA GGYWKTTGKD REVRNGPTTV  120
GMKKTLVFHA GRAPKGERTN WVMHEYRLDG QTTIPPQDSF VVCRIFQKAG PGPQNGAQYG  180
APFVEEEWEE DDEDVGLLPV EEKDNSDDQE KEISGAMEKG YLQMSDLVQN LVDQNENGTI  240
ALPVSDNSNN SNHSEDVDGN SGDILSDQNL GSNFLHHVEP VEQNGLVLNE NMFSSANAGD  300
LFNISSPNDG FLELKDFADI ADLENPLANE STIWPSDGWP WKSTDSMEAV NGASNEFSPL  360
AGEQIFQPEE LEQLLQSLQE DSHMGSTISD PPHSSITNLA KPEEDCLMFY DAPFDSSMCD  420
DGFRQLNGFL GSPSTNLSGI DMVDDGMPYY DAMDDNLFND LLSSVQPSAG SSSHAFSGPV  480
LTQEVNNSTY TYSPTQKVLE PNFVVGAPSS ARLPEADSQT KSSLIGKRFV KILDSISAPP  540
AFAAAEFPAS LRKSLAPISG AHHNTIRVSA EVISIGSLTP DSQDKWSLEK DEGMELLFSA  600
GFEPDTRVHF GCNTITAVLR GGFCLFFFSA IMLLVSYEVG MCIYGNKMGN ASFLGEQFSF  660
TLKEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-47161689168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0697330.0AK069733.1 Oryza sativa Japonica Group cDNA clone:J023030H12, full insert sequence.
GenBankAK0996290.0AK099629.1 Oryza sativa Japonica Group cDNA clone:J013057D07, full insert sequence.
GenBankAK1207730.0AK120773.1 Oryza sativa Japonica Group cDNA clone:J023008J18, full insert sequence.
GenBankKF2802620.0KF280262.1 Oryza sativa Japonica Group NAC transcription factor (NAC40) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649510.10.0uncharacterized protein LOC4346333
TrEMBLA0A0E0QMF50.0A0A0E0QMF5_ORYRU; Uncharacterized protein
STRINGORUFI08G26250.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP71073650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.12e-72NAC domain containing protein 53