PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G25360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 152aa    MW: 16105 Da    PI: 9.6771
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G25360.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1482.7e-1572116549
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                      +r rr++kNRe+A rsR+RK+a+++eLe++v  L aeN aL+ + 
  ORUFI08G25360.1  72 RRKRRAMKNRESAERSRARKQAYLQELEQEVRLLRAENAALRHQC 116
                      699***************************************543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-968133IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.16270115IPR004827Basic-leucine zipper domain
CDDcd147072.04E-1672126No hitNo description
SuperFamilySSF579595.63E-1172118No hitNo description
Gene3DG3DSA:1.20.5.1707.0E-1372118No hitNo description
PfamPF001708.0E-1372117IPR004827Basic-leucine zipper domain
PROSITE patternPS0003607590IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MERAAGTGSG GDDDELVLPP ASFQDGLPSS RSYPSCIGGG SAAAASASLE RELLYRAELH  60
QQQLGGGGGV ERRKRRAMKN RESAERSRAR KQAYLQELEQ EVRLLRAENA ALRHQCHQTL  120
CAHRSELTMA KAAAAAAAAA AAAKKPTSSA TF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0039120.0AP003912.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OJ1479_B11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649649.12e-70PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A0E0QM391e-104A0A0E0QM39_ORYRU; Uncharacterized protein
STRINGLOC_Os08g43600.16e-70(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151931719
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.11e-08abscisic acid responsive element-binding factor 1