PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G24860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 464aa    MW: 49653.2 Da    PI: 7.1309
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G24860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.41.9e-10322378561
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                      kr +r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l +l+  +  l +
  ORUFI08G24860.1 322 KRVKRILANRQSAARSKERKMRYIQELEHKVQVLQTEATTLSAQLTMLQRDSTGLAT 378
                      899******************************************999987766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-18318382IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.829320383IPR004827Basic-leucine zipper domain
PfamPF001703.2E-9322380IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-12322373No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-11322379No hitNo description
CDDcd147033.12E-22323374No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MDDPGAADPG ARPHHLSPGQ PPVVPRSPTP LDLSSAAAAA AAASYRRLSP SLRPPAHPQA  60
RLPSPYPQIP SSSSAAAAGS SGHHARSLSQ PLFFSLDSLP PLPYADLAAP PAIPPSPPSS  120
SSDPPPPGLP PRKGGHRRSQ SDIPFGFSHL SPPLPPPAPV KREAATAAEG CRSDGDDFAL  180
YDLVNSYMDL DGMEALNSSE ERHEDRDSRA SGTRAGSVAD SSENEAESHS TPVERKDGGG  240
KSRHCRSLSV DSFIEKLNFD ESPKLPLPSP SGGLSRSGSG SLDGGAASLF GAEFANGEFT  300
EAEKKKIMAN ERLAEIALTD PKRVKRILAN RQSAARSKER KMRYIQELEH KVQVLQTEAT  360
TLSAQLTMLQ RDSTGLATQN NELKIRLQAM EQQAQLRDAL NEALTAEVQR LKLATGEITD  420
GRMSKGLQQQ MNSQLIQLQQ LQIQQQQSSQ TTQQGQQQQP QKSA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0046320.0AP004632.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0623F08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015651132.10.0PREDICTED: transcription factor VIP1
TrEMBLA0A0E0QLY40.0A0A0E0QLY4_ORYRU; Uncharacterized protein
STRINGLOC_Os08g43090.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-83bZIP family protein