PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G21330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 325aa    MW: 35882.4 Da    PI: 4.5437
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G21330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.53.7e-28958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krien++nrqvtfskRrng++KKA+ELSvLCd++va+++fs++g+l  +s
  ORUFI08G21330.1  9 KRIENTTNRQVTFSKRRNGLIKKAYELSVLCDIDVALLMFSPSGRLSHFS 58
                     79********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.422161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.12E-29284IPR002100Transcription factor, MADS-box
CDDcd002654.74E-38275No hitNo description
PRINTSPR004042.3E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MGRVKLPIKR IENTTNRQVT FSKRRNGLIK KAYELSVLCD IDVALLMFSP SGRLSHFSGR  60
RGVEDVILRY MNLSEHDRGE AIQNREYLIS MLQRLKRESD MATQLANPGA LNEKIEEIQQ  120
EIYSSQQQLQ ITEDRLRMFE PDPAAFGTSS EVDGCEKYLM ELLTRVVERK NNLLSSHMAP  180
FDATTAAMQG ADGTQMYVSQ ADGLATFGGD AAMWGPDGGA DPGHPMFSAS DPLIYLRDHD  240
VYDANSQAYT CTELLSTLIP TTPFPLMPHC LGPEDQYLSM EHGMVAAAQE PVEASTASCS  300
YVPSDENSGT PVMAYDSNPP PANIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-17197194MEF2 CHIMERA
6byy_B1e-17197194MEF2 CHIMERA
6byy_C1e-17197194MEF2 CHIMERA
6byy_D1e-17197194MEF2 CHIMERA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM9565040.0FM956504.1 Oryza sativa Japonica Group mRNA for MADS62 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025883256.10.0agamous-like MADS-box protein AGL66
TrEMBLA0A0E0QKM00.0A0A0E0QKM0_ORYRU; Uncharacterized protein
STRINGORUFI08G21330.20.0(Oryza rufipogon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.12e-67AGAMOUS-like 66