PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G17200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 438aa    MW: 43899.3 Da    PI: 6.7958
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G17200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like51.42.4e-162622922555
          G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       +AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  ORUFI08G17200.1 262 LRATPKSVLELMDVKDLTLAHVKSHLQMYRT 292
                      59****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-14252293IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-11261292IPR006447Myb domain, plants
SuperFamilySSF466894.66E-5263293IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MASATSTTPD LSLHISLPSG GAAVGTTAPP GLGNGGAVGG AGGGKAAGGG DPWRRLDGST  60
ASTELSLSTP QQQQEGSTSA ADVLPWRLRQ PTAAAASVPV TLPTIPMDGS AAAARAPIRG  120
VPVYSGGGGG GHPFLGGGGG DHRHNRLYNP YHSTAWPSSS LCSTSPAPAP PPPPAALDPT  180
TSSLLSPSAY HRMLSSTGRL HGVLADTLRG YAGAAAVAGS IGYGSPGRAA PPMGGAARGG  240
APGGGRPARP ADAVDELPPR PLRATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKSTDKPA  300
AASGPMDGSG SGSGSGDDEL LAGDGRQATS SGADADRRMS FTEHRSSSEG AASHAGGGGD  360
GDCSSSAVNS DTIRARSNSP RDLWLSSSVC NMDPQHLVTV EDMEPCRSSS LQVSSHELSS  420
PSLEFTLGRP SWHSIDHD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14249GGKAAGGG
2237245RGGAPGGGR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2877880.0AK287788.1 Oryza sativa Japonica Group cDNA, clone: J065172N06, full insert sequence.
GenBankAP0044630.0AP004463.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0456B03.
GenBankAP0057340.0AP005734.4 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBb0032E15.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648273.10.0probable transcription factor RL9
SwissprotQ0J2352e-70ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A0E0QJ870.0A0A0E0QJ87_ORYRU; Uncharacterized protein
STRINGORUFI08G17200.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.15e-16G2-like family protein