PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G13980.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 280aa    MW: 31099.5 Da    PI: 8.5733
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G13980.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR39.21.4e-1296134342
              TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                      k +C+Ck skClk+YCeCf++g++C   C+C++C+N+ ++
  ORUFI08G13980.2  96 KTNCSCKYSKCLKLYCECFQKGRYCIG-CNCTNCCNNVNH 134
                      789************************.********9875 PP

2TCR42.71.1e-13177217141
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                      k++kgC+Ck+++ lkkYCeCf+a ++Cse+C+C++CkN ++
  ORUFI08G13980.2 177 KHTKGCKCKRTEYLKKYCECFKASVFCSENCRCTGCKNFKS 217
                      589***********************************765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.0E-794134IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163432.03795217IPR005172CRC domain
PfamPF036381.3E-897131IPR005172CRC domain
SMARTSM011146.1E-13177218IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.5E-10180215IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MSLPSPPLAK KLQVQQSSSI LPQDFPKLEV LPVEKPTKLQ ERRSPQHVSP ELKQGSPKME  60
RPLLPRPATF IDVMLSSQKP SSDMWSETKD VTLTRKTNCS CKYSKCLKLY CECFQKGRYC  120
IGCNCTNCCN NVNHENARHD AINVALERNP AAFMPKVSNS TAHNCESKAA EGDIVGKHTK  180
GCKCKRTEYL KKYCECFKAS VFCSENCRCT GCKNFKSNED RISQKNTVHA HNVQNPASSG  240
MVGQSVIIFH AAENDSSLSL AASVSDHSIN NNTSHLIQVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-259922114127Protein lin-54 homolog
5fd3_B2e-259922114127Protein lin-54 homolog
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0714930.0AK071493.1 Oryza sativa Japonica Group cDNA clone:J023097M11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648875.10.0protein tesmin/TSO1-like CXC 6
TrEMBLA0A0E0QI340.0A0A0E0QI34_ORYRU; Uncharacterized protein
STRINGORUFI08G13980.10.0(Oryza rufipogon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.15e-40Tesmin/TSO1-like CXC domain-containing protein