PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G13980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 289aa    MW: 32218.7 Da    PI: 8.7389
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G13980.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR39.11.5e-12105143342
              TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                      k +C+Ck skClk+YCeCf++g++C   C+C++C+N+ ++
  ORUFI08G13980.1 105 KTNCSCKYSKCLKLYCECFQKGRYCIG-CNCTNCCNNVNH 143
                      789************************.********9875 PP

2TCR42.71.1e-13186226141
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                      k++kgC+Ck+++ lkkYCeCf+a ++Cse+C+C++CkN ++
  ORUFI08G13980.1 186 KHTKGCKCKRTEYLKKYCECFKASVFCSENCRCTGCKNFKS 226
                      589***********************************765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.0E-7103143IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163432.037104226IPR005172CRC domain
PfamPF036381.3E-8106140IPR005172CRC domain
SMARTSM011146.1E-13186227IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.6E-10189224IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MRLGRPAISS HWQNPPLAKK LQVQQSSSIL PQDFPKLEVL PVEKPTKLQE RRSPQHVSPE  60
LKQGSPKMER PLLPRPATFI DVMLSSQKPS SDMWSETKDV TLTRKTNCSC KYSKCLKLYC  120
ECFQKGRYCI GCNCTNCCNN VNHENARHDA INVALERNPA AFMPKVSNST AHNCESKAAE  180
GDIVGKHTKG CKCKRTEYLK KYCECFKASV FCSENCRCTG CKNFKSNEDR ISQKNTVHAH  240
NVQNPASSGM VGQSVIIFHA AENDSSLSLA ASVSDHSINN NTSHLIQVE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0714930.0AK071493.1 Oryza sativa Japonica Group cDNA clone:J023097M11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648875.11e-179PREDICTED: protein tesmin/TSO1-like CXC 6
TrEMBLA0A0E0QI330.0A0A0E0QI33_ORYRU; Uncharacterized protein
STRINGLOC_Os08g28214.11e-165(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP138462025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.17e-40Tesmin/TSO1-like CXC domain-containing protein