PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G11050.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 129aa    MW: 14112.3 Da    PI: 10.322
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G11050.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.51.3e-16950142
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                     k+i n   r v fskRr+ ++KKA+ELS+LC+++vav ++s+
  ORUFI08G11050.4  9 KPIANRKARDVCFSKRRQVVIKKANELSILCGVNVAVAVLSP 50
                     6899***********************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.57E-17151IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.811149IPR002100Transcription factor, MADS-box
SMARTSM004323.4E-14162IPR002100Transcription factor, MADS-box
CDDcd001201.08E-19250No hitNo description
PRINTSPR004043.5E-11323IPR002100Transcription factor, MADS-box
PfamPF003194.4E-171151IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MRRGKVKIKP IANRKARDVC FSKRRQVVIK KANELSILCG VNVAVAVLSP AVEKKKNQRG  60
QDVRLASDVN ALGLHELEAF DSNLNVIDDI VDSNDVVKNA KQTAEPQTQM SVASTLQFML  120
DGQSIAPSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0044581e-129AP004458.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0045D08.
GenBankAP0058191e-129AP005819.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0063H21.
GenBankAP0090791e-129AP009079.1 Oryza sativa Indica Group DNA, chromosome 8, BAC clone: K0031E03.
GenBankAP0090811e-129AP009081.1 Oryza sativa Indica Group DNA, chromosome 8, BAC clone: K0048F05.
GenBankAP0149641e-129AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAY3603941e-129AY360394.1 Oryza sativa (japonica cultivar-group) chromosome 8 BAC OSJNBa0070J19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0QH262e-85A0A0E0QH26_ORYRU; Uncharacterized protein
TrEMBLA0A0E0QH292e-87A0A0E0QH29_ORYRU; Uncharacterized protein
STRINGOPUNC08G17930.12e-63(Oryza punctata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65050.22e-12AGAMOUS-like 31