PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G11050.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 404aa    MW: 45015.4 Da    PI: 6.0906
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G11050.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.27.6e-17229273145
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                      k+i n   r v fskRr+ ++KKA+ELS+LC+++vav ++s+ gk
  ORUFI08G11050.3 229 KPIANRKARDVCFSKRRQVVIKKANELSILCGVNVAVAVLSPAGK 273
                      6899**************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.79E-21221295IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-22221280IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.983221281IPR002100Transcription factor, MADS-box
CDDcd001209.08E-22222278No hitNo description
PRINTSPR004041.5E-13223243IPR002100Transcription factor, MADS-box
PfamPF003198.7E-19231276IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-13243258IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-13258279IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MYSSETGAWS TPVVLDDGLD SWEQRWRDAQ SRGEFYRVPY VMPRRVALVG DEIYFTLRED  60
NAIIKYNWGM HCLSEIDSLS PDVYGIALME MENGSLGFAC IEDSSLYVWS RKVNSEGAAE  120
WVQCRVIKLD KMIPVANLSD EAFVVGSGEG MGAIFVSTGV GLFTIELKSR RVKKVAEPEV  180
YFSILPYMSF YTPALQEWAN YRNKHQHADE AMKAQVIVKA MRRGKVKIKP IANRKARDVC  240
FSKRRQVVIK KANELSILCG VNVAVAVLSP AGKPFFFGCP TVQAVTRRLL GVGPSNPTMG  300
DGGNGDETDI VHELNLKYQK LQQENEVEKK KNQRGQDVRL ASDVNALGLH ELEAFDSNLN  360
VIDDIVDSND VVKNAKQTAE PQTQMSVAST LQFMLDGQSI APSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071120.0AK107112.1 Oryza sativa Japonica Group cDNA clone:002-123-A07, full insert sequence.
GenBankAP0044580.0AP004458.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0045D08.
GenBankAP0058190.0AP005819.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0063H21.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAY3603940.0AY360394.1 Oryza sativa (japonica cultivar-group) chromosome 8 BAC OSJNBa0070J19, complete sequence.
GenBankCP0126160.0CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0QH280.0A0A0E0QH28_ORYRU; Uncharacterized protein
STRINGORUFI08G11050.30.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2310166
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.15e-18AGAMOUS-like 29