PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G05160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 362aa    MW: 40099.4 Da    PI: 6.6408
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G05160.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.61.9e-115187238
                     XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeL 38
                     +++k +rr+++NReAAr+sR+RKka+i++Le+   +L
  ORUFI08G05160.1 51 PRDKIQRRLAQNREAARKSRLRKKAYIQNLETSRMKL 87
                     57999*************************9854444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-450107IPR004827Basic-leucine zipper domain
PfamPF001701.2E-85287IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.5315294IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.69E-754100No hitNo description
Gene3DG3DSA:1.20.5.1705.2E-855100No hitNo description
PROSITE patternPS0003605772IPR004827Basic-leucine zipper domain
PfamPF141442.2E-27139213IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MVVAPPPLTE PKFESQLALP LQHGDDQDNA AALQESPRHA SDSFEQEASK PRDKIQRRLA  60
QNREAARKSR LRKKAYIQNL ETSRMKLAHL EQEITRARQQ SAYINRSSNP ATLPAPIDSG  120
VVTFEVEYAQ WVEEQGRQTA ELRASLQAAA EGPELRAVVE AALAHYDRLF AAKREAARRD  180
VFFVMSGVWR TGAERFFLWI AGFRPSEVIR VLAPQLEPMT ERQAADVQGL QQKARHLEDA  240
LSQGMDKLKQ TLADSLLAEA VVVSTSCDAS PPPPPPEEEE PSSSAAGDGG CYMAQMGSAM  300
GRLSNLVAFV DHADHLRQET LQNMYKILTL PQAARGLLAL GDYCQRLRAL SSLWAARPRE  360
PA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8315140.0CT831514.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA129B22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650460.10.0PREDICTED: transcription factor TGA6 isoform X2
SwissprotQ391621e-118TGA4_ARATH; Transcription factor TGA4
TrEMBLA0A0E0QF200.0A0A0E0QF20_ORYRU; Uncharacterized protein
STRINGLOC_Os08g07970.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35713877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-118TGACG motif-binding factor 4