PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G01040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 404aa    MW: 43957.4 Da    PI: 9.6115
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G01040.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.45.8e-49311562128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                      +pGfrFhPt+eel+ +yL++kvegk++++ e i+ vd+y+++PwdLp+ ++ ++kew+f+++rd+ky++g+r+nr+t sgyWkatg d+ v+++
  ORUFI08G01040.1  31 MPGFRFHPTEEELIEFYLRRKVEGKRFNI-ELIAFVDLYRYDPWDLPALASIGDKEWFFYVPRDRKYRNGDRPNRVTPSGYWKATGADRMVKVE 123
                      79***************************.89***************888889***************************************** PP

              NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkktLvfy g+apkg +++W+m+eyrl
  ORUFI08G01040.1 124 GDRPIGLKKTLVFYVGKAPKGLRSSWIMNEYRL 156
                      *******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5630176IPR003441NAC domain
PROSITE profilePS5100555.0330176IPR003441NAC domain
PfamPF023651.8E-2432156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MRGSDHHQDV VAAPRGGGGG GDDGQAHDMV MPGFRFHPTE EELIEFYLRR KVEGKRFNIE  60
LIAFVDLYRY DPWDLPALAS IGDKEWFFYV PRDRKYRNGD RPNRVTPSGY WKATGADRMV  120
KVEGDRPIGL KKTLVFYVGK APKGLRSSWI MNEYRLPHGD ADRYQKEISL CRVYKRPGIE  180
DNFHLTGTTT KSSGSKAAAA MGKKHAAANR TSSTAAAAAP RLAPMFDGGG GGGHHSSALM  240
GKATYNASHT AAEGTNAIAM SLSAAAALHP PAPAMFRSTA SVASLSSTTS TEEDGTSLFH  300
LKAGATTTNT TTMHHHHHHQ QLPASTHALL NTNSSAMATI PIDELSRAIG SYSNIHHQPN  360
STTTHQSTAL PPSQQSPLLP FASMEKIWDW NPLLESPKVC TNFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-543217619165NO APICAL MERISTEM PROTEIN
1ut4_B2e-543217619165NO APICAL MERISTEM PROTEIN
1ut7_A2e-543217619165NO APICAL MERISTEM PROTEIN
1ut7_B2e-543217619165NO APICAL MERISTEM PROTEIN
4dul_A2e-543217619165NAC domain-containing protein 19
4dul_B2e-543217619165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0710520.0AK071052.1 Oryza sativa Japonica Group cDNA clone:J023075E09, full insert sequence.
GenBankAK0722750.0AK072275.1 Oryza sativa Japonica Group cDNA clone:J023012F04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006659059.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
TrEMBLA0A0E0QDK30.0A0A0E0QDK3_ORYRU; Uncharacterized protein
STRINGORUFI08G01040.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77063650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.25e-97NAC domain containing protein 35