PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI07G27400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 331aa    MW: 35480.5 Da    PI: 6.4394
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI07G27400.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1271e-081341731352
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                      NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  ORUFI07G27400.1 134 NRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 173
                      *********************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.8E-6132186IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-9133177No hitNo description
CDDcd147036.28E-19133176No hitNo description
Gene3DG3DSA:1.20.5.1703.9E-9134180No hitNo description
PfamPF001706.5E-7134170IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.036134187IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MAMPPKPGDQ PSPGRSPNPN LNLPCPLPPI PSCGGGGGGA GPTPPPPPPP PHHRRARSEV  60
AFRFPDDLGL GGGADGGGFD EIGSEDDLFS TFMDMEKIAG ADRDRAAETS SPPRPTKHRH  120
SASFDGFAFG AGANRQSAAR SKERKARYIT ELERKVQTLQ TEATTLSAQL TLFQRDTTGL  180
SAENAELKIR LQAMEQQAQL RDALNDALKQ EVERLKIATG EMAKSNDAYN TGMQQVPYSP  240
SFFQLSDQHA VQHHAGVQQL PHQFQQPHPS VPSHQMLSHP NSLSDMMQQD SLGRLQGLDI  300
GKGPVAVKNE AEVVVKSEGS SISAGESNST F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1025620.0AK102562.1 Oryza sativa Japonica Group cDNA clone:J033097I23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646776.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-119RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0E0QCT10.0A0A0E0QCT1_ORYRU; Uncharacterized protein
STRINGLOC_Os07g48180.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-61bZIP family protein