PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI07G12260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 196aa    MW: 22482 Da    PI: 4.8786
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI07G12260.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.3e-2156107556
                      SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       ++t++q++ Le++Fe++ y+  ++r eLAkklg++erqVk+WFqNrR+++k
  ORUFI07G12260.1  56 KRHTDDQIKHLESVFERCTYLGGNQRVELAKKLGMEERQVKFWFQNRRTRKK 107
                      579***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-2141108IPR009057Homeodomain-like
PROSITE profilePS5007116.82749109IPR001356Homeobox domain
SuperFamilySSF466895.43E-1950107IPR009057Homeodomain-like
SMARTSM003891.2E-1751113IPR001356Homeobox domain
CDDcd000861.47E-1853107No hitNo description
PfamPF000461.5E-1856107IPR001356Homeobox domain
PRINTSPR000311.4E-68089IPR000047Helix-turn-helix motif
PROSITE patternPS00027084107IPR017970Homeobox, conserved site
PRINTSPR000311.4E-689105IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MDNGSQQESS DLHVHHLPIA SVIGVEDRTE EADDAAVDYH DDSSEGQDEV SNKRMKRHTD  60
DQIKHLESVF ERCTYLGGNQ RVELAKKLGM EERQVKFWFQ NRRTRKKMHD ERQEGMWLQE  120
ENDVLHAENK VLKEAMWANI CFTCGSPVVP AIPTVQHQYL SFQNMRLADE LQHATAVFNM  180
VAQDADVGLA TSVPFD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126151e-148CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
GenBankAP0149631e-148AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0056901e-148AP005690.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBa0052I14.
GenBankAP0042981e-148AP004298.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0409D09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0Q7D41e-147A0A0E0Q7D4_ORYRU; Uncharacterized protein
STRINGBGIOSGA024401-PA1e-131(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149301619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.16e-34homeodomain GLABROUS 1