PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI06G24410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 268aa    MW: 27690 Da    PI: 8.765
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI06G24410.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.74.5e-071672092163
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      R RKk+++ e ++ v +L+ eN+ L++e+  l+  + +l +e+
  ORUFI06G24410.1 167 RPRKKMRLPEIQQLVRSLTVENDGLREEMVALQRACTALSKEN 209
                      89***********************************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.7E-4167206No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MTAADAEACA VAAAADIICS LRGADLAGWT PPWGTAAAKG KEVVVEEEEE ELAWPTVARG  60
KRSRSSRRRS PSGSGSAATK GRWARGSPAS PLDYSGGSGS GSGSAASTSG GEDGAFCSPP  120
PPPPPVVTAA AATTPTAAPT PSPAKVGPAG RRQLILPTPP PRPAGQRPRK KMRLPEIQQL  180
VRSLTVENDG LREEMVALQR ACTALSKENC KLETRLEKSS KRNGTKSEGQ QARPQPDEPA  240
AKQESQNGFV LPDLNLPVED MAADGSAP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1166172RPRKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0040080.0AP004008.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OJ1226_A12.
GenBankAP0035170.0AP003517.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0062J02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644355.10.0PREDICTED: translation initiation factor IF-2
TrEMBLA0A0E0Q0T90.0A0A0E0Q0T9_ORYRU; Uncharacterized protein
STRINGBGIOSGA020785-PA1e-107(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951