PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI06G14240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 238aa    MW: 27025.1 Da    PI: 10.0929
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI06G14240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.66.8e-18957149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     kri+n+  rqv fskRr  ++KKA+EL + C+aeva+++ s+ gk++ +
  ORUFI06G14240.1  9 KRIKNEEARQVCFSKRRPSVFKKASELYTVCGAEVAMLVKSPAGKFFSF 57
                     79********************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.862161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-23176IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-23160IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-15323IPR002100Transcription factor, MADS-box
PfamPF003199.6E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MTKRKIEIKR IKNEEARQVC FSKRRPSVFK KASELYTVCG AEVAMLVKSP AGKFFSFGAP  60
SVGFVLSRFH ATTTSRKHSS MGVTIQHDNS ATIKLHELNQ QHIELQNQLQ AQNEKMKALQ  120
EVAKKESGGK VMGWLNSKVE DICQEDLEEF KMVLESLKYL TRGIINQLFQ NYAMFSNMMR  180
VQHCVTALPN QQFLPSSEDV KPMIHHVPSS SYGWNTSIDS KPNSSDAHVV GARRYFPK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037630.0AP003763.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0531C01.
GenBankAP0047840.0AP004784.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0012F14.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642726.10.0agamous-like MADS-box protein AGL61
TrEMBLA0A0E0PXB41e-179A0A0E0PXB4_ORYRU; Uncharacterized protein
TrEMBLQ69WG71e-179Q69WG7_ORYSJ; MADS-box protein-like
STRINGORUFI06G14240.11e-180(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP169561112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.14e-24AGAMOUS-like 61