PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI06G14210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 499aa    MW: 54268.6 Da    PI: 7.4585
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI06G14210.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.27.6e-1479116240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +kk+CnCk+s+Clk+YCeCfaag +C+  C+C++C N  
  ORUFI06G14210.1  79 RKKHCNCKNSQCLKLYCECFAAGLYCDG-CHCKQCGNYV 116
                      689*************************.*******975 PP

2TCR513e-16163202140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      k++kgC+Ckks ClkkYCeCf+a+  Cs++CkC+dCkN e
  ORUFI06G14210.1 163 KHNKGCHCKKSGCLKKYCECFQANILCSKNCKCQDCKNFE 202
                      589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.7E-1378118IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.49779203IPR005172CRC domain
PfamPF036381.3E-1080115IPR005172CRC domain
SMARTSM011141.5E-18163204IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12166201IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MEKKQMQQQP QQPESEPEPA APAPAAAAAE AKATPPQPQP QQKPAAPVQP QMPTPRPWPV  60
AFIPPKPVAE IKSTPSTKRK KHCNCKNSQC LKLYCECFAA GLYCDGCHCK QCGNYVGNES  120
ARQEAINSTK QRNPKAFQPK IENGSNALNL RKDDAGAPAS LPKHNKGCHC KKSGCLKKYC  180
ECFQANILCS KNCKCQDCKN FEGSEELRLI TQGDNSSDRN NIQHAANVAL NGAIGSSGYR  240
YSPVRRKRPP EDHLYQKLNG EGSTMQTQFQ EANHVDSSEI TSSTGLEGCY SNYQSRSNVV  300
YRSALANTIS PTDATGLAKH LVIVCRKAAD AFLTTAENKG EMEVEREIHT DSDGATNMDQ  360
QNGGDFGPCC NSLEDSRPAS PGTQALMCDE QDSTFGTDYR ISFPVALHDQ DTSELNAQQE  420
KAVLTGFRDY LRTVITRGKI NEANRSSEAA MQLDTRKHDE SATILPPLNA VEKEKLKVPD  480
GPESPKASPS ASNCGGQAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A8e-26732124132Protein lin-54 homolog
5fd3_B8e-26732124132Protein lin-54 homolog
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8362560.0CT836256.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA111J17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641295.10.0protein tesmin/TSO1-like CXC 7
TrEMBLA0A0E0PXB10.0A0A0E0PXB1_ORYRU; Uncharacterized protein
STRINGORUFI06G14210.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57552653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.14e-89Tesmin/TSO1-like CXC domain-containing protein