PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI06G08110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 360aa    MW: 40098.9 Da    PI: 4.3704
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI06G08110.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.18.3e-27958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krien+ nrqvtfskRrng++KKA+ELSvLCd+++a+++fs++g+l  +s
  ORUFI06G08110.1  9 KRIENNPNRQVTFSKRRNGLIKKAYELSVLCDIDIALLMFSPSGRLSHFS 58
                     79********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.226161IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-36160IPR002100Transcription factor, MADS-box
CDDcd002656.41E-36278No hitNo description
SuperFamilySSF554554.97E-29284IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-25323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRVKLQIKR IENNPNRQVT FSKRRNGLIK KAYELSVLCD IDIALLMFSP SGRLSHFSGR  60
RRIEDVLTRY INLPESDRGG TIQNREYLIN MLTQLKCESD VTEDLTNTSS KAPVNSNIEE  120
LQQEIRRCQH QMQLTEEQLR MFEPDPARSA SMEDVEASEK FIAGILSRVE ERKRYLLCSM  180
GSFDVTASTS AMQHLYLPQQ HQHGDITDNG FGSDEVASWV SEGMPPTTSS VASIFAGTSD  240
SMMSFRDQAV YDTMRQDACV DQTVVPEMGM CHVDQQNQSD DWQAYTSAEF LNALIPPTPF  300
PLDDEDTMGP MLASSPLLMP GIHDQQPPEE DMATAGCSQA PANDGNGLYA AEDIAPVNVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A4e-17182183MEF2 CHIMERA
6bz1_B4e-17182183MEF2 CHIMERA
6bz1_C4e-17182183MEF2 CHIMERA
6bz1_D4e-17182183MEF2 CHIMERA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117760.0AK111776.1 Oryza sativa Japonica Group cDNA clone:J023075K19, full insert sequence.
GenBankFN6631300.0FN663130.1 Oryza sativa Japonica Group mRNA for MADS63 protein, cultivar Nipponbare.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641968.20.0agamous-like MADS-box protein AGL66
TrEMBLA0A0E0PV940.0A0A0E0PV94_ORYRU; Uncharacterized protein
STRINGORUFI06G08110.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49533360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.11e-73AGAMOUS-like 66