PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G24120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family VOZ
Protein Properties Length: 657aa    MW: 71618.1 Da    PI: 5.547
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G24120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ420.13.8e-1293245411217
              VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaa 93 
                      p+ps++lgpkcalwdc rp++gs+++q+yc+ +ha laln+ gl+gt+pv+rp+gidlkdg+lfaalsakvqgk+vgip+cegaat+kspwna+
  ORUFI05G24120.1 324 PSPSQYLGPKCALWDCGRPVRGSDECQHYCNPYHAGLALNDdGLLGTRPVMRPRGIDLKDGPLFAALSAKVQGKNVGIPVCEGAATTKSPWNAP 417
                      89**************************************9799************************************************** PP

              VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlel 187
                      elfdlsllege++rewlffd+prraf+sgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqpss++ewhl+eye+n++dalalyrle+
  ORUFI05G24120.1 418 ELFDLSLLEGESLREWLFFDTPRRAFDSGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSSNYEWHLFEYETNDSDALALYRLEY 511
                      ********************************************************************************************** PP

              VOZ 188 klvdekksakgkvskdsladlqkklgrlta 217
                      k++d+k+s+k+k+++++l+++q++++rl+a
  ORUFI05G24120.1 512 KSSDTKRSVKSKLASSPLSEIQQQMVRLSA 541
                      ****************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
MAGDPAAGGD GGRGSSGGKG SSRSSSRHQQ FRNLAKTRVD DLQEMFSGLQ SARKESRSAD  60
AALLEEQVHH MLREWRAELN VPSPASSLQA IPPNPSFPPS SFTCANSQSQ GNNREASDPP  120
SETLRLLQLA GAEEEDDATS KLVMPRSPMP MQSSHEGHNL SPVLQGGTMA GGAAELMVPR  180
SPLQQMPSSH QSHGHGQDGG QNLQGEAVMG STAATAAPHL VQGMQGDCGG MAGVTNAMFH  240
DQLYYIDHEL NIDDFLQDDD YKINLPGSNP DGPNTMQGIG QLEHQQYNLP LDLPPNSFVD  300
ANNSAQSSGD VFFHMSDLLT TMCPSPSQYL GPKCALWDCG RPVRGSDECQ HYCNPYHAGL  360
ALNDDGLLGT RPVMRPRGID LKDGPLFAAL SAKVQGKNVG IPVCEGAATT KSPWNAPELF  420
DLSLLEGESL REWLFFDTPR RAFDSGNRKQ RSLPDYNGRG WHESRKQVMK DFGGLKRSYY  480
MDPQPSSNYE WHLFEYETND SDALALYRLE YKSSDTKRSV KSKLASSPLS EIQQQMVRLS  540
ADSPVESKRT ARSRAKANQK DNNSNAYPAL NTPVQVSASN AHQTMSVNTP DQVNVSNAYQ  600
TMPLNTPNQP GPSNAYHAAS QMDQMTFLDG SVVYGPHLPY GYSTERSDFY WNPSDGT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0690760.0AK069076.1 Oryza sativa Japonica Group cDNA clone:J023004H20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640409.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-114VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0E0PPY50.0A0A0E0PPY5_ORYRU; Uncharacterized protein
STRINGORUFI05G24120.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-111vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]