PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G23610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 385aa    MW: 42529.4 Da    PI: 8.148
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G23610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.85e-1485122340
              TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +k+C Ckks+Clk+YC Cfa g +Cse+C C+ C+Nk 
  ORUFI05G23610.1  85 CKHCACKKSRCLKLYCPCFAGGGYCSEKCGCQPCFNKA 122
                      89**********************************85 PP

2TCR49.96.2e-16181217339
              TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      ++gCnCkks+ClkkYC+C+++g+ Cs  C+CedC+N 
  ORUFI05G23610.1 181 RRGCNCKKSSCLKKYCDCYQDGTGCSLFCRCEDCRNP 217
                      589********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.1E-1283124IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163430.01984219IPR005172CRC domain
PfamPF036385.7E-1086121IPR005172CRC domain
SMARTSM011141.7E-15179220IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.8E-11182216IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MEATPISVKP PSPVAAAPPP PPVQVPVPPP PPPPLPPAAA AVEPLPPQPV AVVVAEAEPC  60
SMNQLALTPT PKRQKVEESA DGNGCKHCAC KKSRCLKLYC PCFAGGGYCS EKCGCQPCFN  120
KALYAETVQT TRKVLLSRQK RMSLKINRRS EANAEAVVVF LTEKAGATED AHHSSSSTPP  180
RRGCNCKKSS CLKKYCDCYQ DGTGCSLFCR CEDCRNPFGK NEGIMAEESK RFLYTGADLD  240
HSEDEQDFIV ERSPRLQSPI SKESSFQQTP PHIRATNRDT HMFPQAISQW QPRSWHCSKR  300
QSNDRVIDDS GEYKNSNHDW QLAKPEDSYS ISRCVQILNG MAELSQVEKS VAPDVFLQAG  360
NREIFISLNG DVRALWLKRK IQNLT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1080530.0AK108053.1 Oryza sativa Japonica Group cDNA clone:002-137-H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640211.10.0PREDICTED: protein tesmin/TSO1-like CXC 3 isoform X1
TrEMBLA0A0E0HGR70.0A0A0E0HGR7_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PPS50.0A0A0E0PPS5_ORYRU; Uncharacterized protein
STRINGORGLA05G0194300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101592937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.11e-42Tesmin/TSO1-like CXC domain-containing protein