PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G19090.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 388aa    MW: 40597.9 Da    PI: 11.2536
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G19090.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.73e-14300352355
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      + +r++r++kNRe+A rsR+RK+a+i+eLe  v+eLe+e  +L  e ee +++
  ORUFI05G19090.2 300 AMQRQKRMIKNRESAARSRERKQAYIAELEAQVAELEEEHAQLLREQEEKNQK 352
                      679***************************************99877765554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-10298367IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875300348IPR004827Basic-leucine zipper domain
PfamPF001703.0E-12300351IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.48E-10302351No hitNo description
CDDcd147071.61E-18302348No hitNo description
Gene3DG3DSA:1.20.5.1705.3E-13303349No hitNo description
PROSITE patternPS000360305320IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MIPISTVFTP TLVKDLSRAD NPRPRAGGLA KTQKHTHAAH SAVTHTRGLP PSLPHVTSHA  60
SRRSLAFALV SSTLSLFPFR LQPTNHPPTT ARAAVQPASC RAARGRRGSG AGGRMASSRV  120
MAAAAASSSS SPPPPPPAAA AAGGAADLAR FRSTSSGIGS MNMDDILRNI YGEAAPPPGA  180
AGSAPAPPPA GEAAGAPVAE VAARRTAEEV WKEISSSGGL SAPAPAPAAG AAGRGGGPEM  240
TLEDFLARED DPRATAVEGN MVVGFPNVTE GVGTAGGGRG GGGGGRGRKR TLMDPADRAA  300
MQRQKRMIKN RESAARSRER KQAYIAELEA QVAELEEEHA QLLREQEEKN QKRLKEKWHV  360
FMQIKEQAVA VVIRKKTQDL RRTNSMEW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276284GGRGGGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBMTransfer from LOC_Os05g36160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126130.0CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
GenBankAC1349300.0AC134930.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0042J17, complete sequence.
GenBankAC1053180.0AC105318.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1058_F05, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639395.11e-120PREDICTED: G-box-binding factor 4
TrEMBLA0A0E0PN120.0A0A0E0PN12_ORYRU; Uncharacterized protein
STRINGBGIOSGA019930-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.12e-12bZIP family protein