PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G17750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 312aa    MW: 34089.4 Da    PI: 4.6038
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G17750.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM145.72.5e-45101381128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lp GfrFhPtdeelv +yL+++++g ++++  +i++v+iy+++Pw+Lp+++  +e+ewyfF+ rd++y+++ r++r+++sg+Wkatg+dk+v +
  ORUFI05G17750.1  10 LPTGFRFHPTDEELVINYLQRRATGLSCPI-PIIADVEIYNFNPWELPSMALFGEHEWYFFTLRDHRYPNSVRPSRSAASGFWKATGTDKPVQV 102
                      699***************************.88***************76667999************************************99 PP

              NAM  95 k..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +  +++ + +kk Lvfy gr p  +kt+W+mheyrl
  ORUFI05G17750.1 103 AnmQSTPIAMKKALVFYVGRPPMETKTTWIMHEYRL 138
                      8667777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.45E-563173IPR003441NAC domain
PROSITE profilePS5100552.47310173IPR003441NAC domain
PfamPF023655.0E-2411138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MAMQLSLPVL PTGFRFHPTD EELVINYLQR RATGLSCPIP IIADVEIYNF NPWELPSMAL  60
FGEHEWYFFT LRDHRYPNSV RPSRSAASGF WKATGTDKPV QVANMQSTPI AMKKALVFYV  120
GRPPMETKTT WIMHEYRLTN TRGSTASHPS LSSSTAHPSV KLDEWVLCKI FNKSPEPDNT  180
APPSNVVSRL QCSPPLPPPA APPGNYPPLP AGATNDGGVF AGAGDMLFTI QEHQEGTPSM  240
LPPIPNLEPP AATIGNSSLN GTTAAAAAAA ADGHGLVEEE DTSAYTFTDQ EMEQMLMDLM  300
DQDFFGNDQP QE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-581017615171Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1073300.0AK107330.1 Oryza sativa Japonica Group cDNA clone:002-126-F03, full insert sequence.
GenBankEU8469990.0EU846999.1 Oryza sativa Japonica Group clone KCS021f05 NAM protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638459.10.0NAC transcription factor 25
SwissprotQ8GY424e-68NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A0E0PMJ00.0A0A0E0PMJ0_ORYRU; Uncharacterized protein
STRINGORUFI05G17750.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162071212
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-65NAC domain containing protein 25