PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G13610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 200aa    MW: 21105.8 Da    PI: 6.7789
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G13610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.21.7e-4461051100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+C+kdC++ap fpa++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +l
  ORUFI05G13610.1   6 PCASCKLLRRRCTKDCIFAPFFPADDPHKFAIVHKVFGASNVSKMLQELPAQQRGDAVSSLVYEANARMRDPVYGCVGAISFLQNQVSQLQMQL 99 
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  ORUFI05G13610.1 100 AVAQAE 105
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6065106IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-436103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MGGGSPCASC KLLRRRCTKD CIFAPFFPAD DPHKFAIVHK VFGASNVSKM LQELPAQQRG  60
DAVSSLVYEA NARMRDPVYG CVGAISFLQN QVSQLQMQLA VAQAEILCIQ MQHRDDGAAH  120
QLDAAADHHP LLDQQQQQQM VVDAADAAAS FLVQNGGGGG GPAAQLISGY GSPAAGGGGG  180
HGVVHYAAAQ EHLKRESLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-4821077112LOB family transfactor Ramosa2.1
5ly0_B6e-4821077112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1349280.0AC134928.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone B1164G01, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638859.11e-145LOB domain-containing protein 12
SwissprotQ8LBW33e-72LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0D9ZXQ91e-143A0A0D9ZXQ9_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0HD051e-143A0A0E0HD05_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PL281e-143A0A0E0PL28_ORYRU; Uncharacterized protein
TrEMBLA0A0P0WKY81e-143A0A0P0WKY8_ORYSJ; Os05g0346800 protein (Fragment)
TrEMBLA2Y3H81e-143A2Y3H8_ORYSI; Uncharacterized protein
TrEMBLQ5W6R01e-143Q5W6R0_ORYSJ; Os05g0346800 protein
STRINGOGLUM05G13250.11e-144(Oryza glumipatula)
STRINGORUFI05G13610.11e-144(Oryza rufipogon)
STRINGOS05T0346800-001e-144(Oryza sativa)
STRINGONIVA05G13090.11e-144(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-71LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]