PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G11630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 218aa    MW: 24082.5 Da    PI: 8.8125
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G11630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.37.4e-171664149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     krie k  r v fskRr++++ KA ELS LC+a++a +++s+ g+ + +
  ORUFI05G11630.1 16 KRIEKKDARDVCFSKRRQTLFNKAGELSLLCNANIAAVVISPAGRGFSF 64
                     79****************************************9986655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.399868IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-24867IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-22979IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-151030IPR002100Transcription factor, MADS-box
PfamPF003196.7E-191764IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-153045IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-154566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MVKGKGRAGR KKVEIKRIEK KDARDVCFSK RRQTLFNKAG ELSLLCNANI AAVVISPAGR  60
GFSFAHPSVD DVADRLASMA MGIPNNHSLG GGYHDSGEVT NIAQQQKIEY VELQKSLEKS  120
EKKKRVQEAM EKERAGHLMQ SLTSEVNLLG QDELEELHNK LSALPYTSIA KFYQVLQDAK  180
GTRMPLPQPH IEIACQSQFL FEEQAVTPAN ADFPGSST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0985720.0AC098572.2 Oryza sativa (japonica cultivar-group) chromosome 5 BAC clone OJ1234_D05, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638580.11e-162agamous-like MADS-box protein AGL61
TrEMBLA0A0E0PKD41e-161A0A0E0PKD4_ORYRU; Uncharacterized protein
TrEMBLA2Y2Y51e-161A2Y2Y5_ORYSI; Uncharacterized protein
TrEMBLB9FK571e-161B9FK57_ORYSJ; Os05g0303400 protein
STRINGORUFI05G11630.11e-162(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP157431316
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-15AGAMOUS-like 61