PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G04770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 208aa    MW: 21698.8 Da    PI: 8.8075
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G04770.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.12e-40281271100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C+++pyf   +p+kfa vhk+FGasnv+k+l +++e++r da++slvyeA+ r+rdPvyG++g il+lqqq++ l+ael
  ORUFI05G04770.1  28 PCAACKLLRRRCAQECPFSPYFSPLEPHKFASVHKVFGASNVSKMLLEVHESQRGDAANSLVYEANLRLRDPVYGCMGAILTLQQQVQALEAEL 121
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++ 
  ORUFI05G04770.1 122 AAVRAD 127
                      *99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.22727128IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-4028125IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MMARRSCSMP AAGAGPGSAA AAVNTITPCA ACKLLRRRCA QECPFSPYFS PLEPHKFASV  60
HKVFGASNVS KMLLEVHESQ RGDAANSLVY EANLRLRDPV YGCMGAILTL QQQVQALEAE  120
LAAVRADIVR HKYRLPSAAA VLPSSHASHL LAAAAAARQL PVAGTMGVVT TATLPASASS  180
SSTTAVYAAA SSSTDYSSIT NENVPYFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-402813111114LOB family transfactor Ramosa2.1
5ly0_B4e-402813111114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1343410.0AC134341.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0027N19, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025881485.11e-150LOB domain-containing protein 15 isoform X1
SwissprotQ9AT616e-67LBD13_ARATH; LOB domain-containing protein 13
TrEMBLC7J2W51e-148C7J2W5_ORYSJ; Os05g0165450 protein
STRINGORUFI05G04770.11e-149(Oryza rufipogon)
STRINGOS05T0165450-001e-148(Oryza sativa)
STRINGONIVA05G04920.11e-149(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.12e-58LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]