PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G01750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 140aa    MW: 14537.5 Da    PI: 4.7543
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G01750.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26060.83.6e-19116645100
           DUF260  45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                       l++lpee+r da+ss+vyeA+ar+rdPvyG++g i +lq+q++ lka+la++++e
  ORUFI05G01750.1  11 WLQELPEEQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVNDLKAQLARAHAE 66 
                      5899************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.902167IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-171164IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MASSPLMSPS WLQELPEEQR ADAVSSMVYE ANARIRDPVY GCAGAICQLQ KQVNDLKAQL  60
ARAHAELAGA RAQHAHLVAL LCMEMAAAAP PQHPTTTAAA AAYCAASPAA PVDALYVVDG  120
AGAAAMQASP IGWGDEPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-17106754111LOB family transfactor Ramosa2.1
5ly0_B2e-17106754111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0790210.0AC079021.5 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0008A07, complete sequence.
GenBankAC0930890.0AC093089.1 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1729_E02, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638880.11e-76LOB domain-containing protein 1
SwissprotQ9LQR02e-25LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK083e-25LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0E0PGW31e-94A0A0E0PGW3_ORYRU; Uncharacterized protein
STRINGORUFI05G01750.12e-95(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-20LOB domain-containing protein 1