PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI04G32600.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 898aa    MW: 101193 Da    PI: 7.1249
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI04G32600.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.53.1e-505286561129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhPtd el v+yLk+k+ gk+l++ ++++e+d+yk+ PwdLp k +++++++ewyfF++rd+ky++g+r+nr+t++gyWkatgkd++v
  ORUFI04G32600.2 528 LPPGFRFHPTDVELTVYYLKRKLLGKHLRC-NAVSELDLYKFAPWDLPeKsSLQSKDREWYFFCPRDRKYSSGSRTNRSTEAGYWKATGKDRPV 620
                      79****************************.89**************95357788999************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +  ++++vg+k+tLvf+ g+ p+g +tdWvm eyrle
  ORUFI04G32600.2 621 IY-NSQTVGMKRTLVFHLGKPPRGDRTDWVMYEYRLE 656
                      **.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF030164.6E-4253340IPR004263Exostosin-like
SuperFamilySSF1019419.29E-61519678IPR003441NAC domain
PROSITE profilePS5100556.488528678IPR003441NAC domain
PfamPF023656.9E-26529655IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005768Cellular Componentendosome
GO:0005802Cellular Componenttrans-Golgi network
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 898 aa     Download sequence    Send to blast
MRSSHQPLCT RAHQAAALLL VAATFFLTRL LDRSPLSAPP PPCAAPYSPW PHRDLRIYVY  60
AEDEVDGLRA LLRGRNDDVT AATCIKGQWG TQVKIHQLLL SSRFRTFDKD EADLFFVPTY  120
VKCVRMTGKL NDKEINQTYV KVVLSQMPYF RRSGGRDHIF VFPSGAGAHL FRSWATFLNR  180
SIILTPEGDR TDKRGISAFN TWKDIIIPGN VDDSMVKSDR LAVKPIPLTK RKYLANFLGR  240
AQGKVGRLQL VKLAKQYPDK LESPELKLSG PDKLGRIDYF KHLRNAKFCL APRGESSWTL  300
RFYESFFVEC VPVILSDEVE LPFQNVIDYT EVSIKWPASK IGPGLLEYLE SIPDGRVEEM  360
IGRGREIRCL WMYAADTERC SAMSAIMWEL QRKVRRFHQS AETFWLHNRS IVNRDLVEFH  420
EWRMPRFGGE EEEGRRRREP PASLRCAPPL SNSTSPLLLA NTPASCVPFP SPLLSSQSLI  480
PPLSYRIRIS TTIHHLLSAA APHFLPSPTA TTSYRQRSIL LSMAKTSLPP GFRFHPTDVE  540
LTVYYLKRKL LGKHLRCNAV SELDLYKFAP WDLPEKSSLQ SKDREWYFFC PRDRKYSSGS  600
RTNRSTEAGY WKATGKDRPV IYNSQTVGMK RTLVFHLGKP PRGDRTDWVM YEYRLEDKEL  660
SASGVKLDAC VLCKIFQKSG PGPKIGEQYG APFNEDDWNE ANGELSSFAF SVPPCALESS  720
NGRLNTAGQQ LAVSDNIGSS LDHCSETNDK IAVGGCGTTS PSVPFDTIHT QQLAEIISCF  780
STDLLNSVSR DGSLPDSTAD YDNDNEVSSD DGEAIFNELD ELDSQSDESI SNHCNSCGED  840
LIPPTLEVLK TEQYLELNDL SFSLADDPDP CNLLLTTNLS DQNHPELETS SNRKVLRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4952467811168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0646460.0AK064646.1 Oryza sativa Japonica Group cDNA clone:002-114-D03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0PG860.0A0A0E0PG86_ORYRU; Uncharacterized protein
STRINGORUFI04G32600.20.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP993277
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.42e-77NAC domain containing protein 82