PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI04G28400.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 423aa    MW: 48121.6 Da    PI: 5.7128
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI04G28400.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.74.4e-12129169242
                      XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeN 42 
                      +++k+ rr+++NReAAr+sR+RKka+i++Le+   +L +  
  ORUFI04G28400.4 129 PPDKVLRRLAQNREAARKSRLRKKAYIQQLETSRLKLAQLE 169
                      5799***************************8544443333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-11128192IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.933130174IPR004827Basic-leucine zipper domain
PfamPF001709.4E-9130170IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.95E-7132178No hitNo description
CDDcd147089.10E-22132181No hitNo description
Gene3DG3DSA:1.20.5.1707.2E-8134182No hitNo description
PROSITE patternPS000360135150IPR004827Basic-leucine zipper domain
PfamPF141444.4E-26220296IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MQLIFPLWHM NLCSIIIGGD QFKNDIMELY PGYLEDHFNI HKLSISSASP PEYMTSASTQ  60
FAAPVRMGAY DRPPPVGMWS HEQFKVDNGQ ATSASTIMEA EMKFENRLEE IPQVVLEEGR  120
NVDQEASKPP DKVLRRLAQN REAARKSRLR KKAYIQQLET SRLKLAQLEQ ELQRARQQAV  180
YANGSLREPN LGFTGPIDPG ALGFEIKYSH WVDEQNRNTG ELRNALLQGQ TTDQDLELKL  240
LVEAGLDNYN RLFEMKEEAA NSDVFYIMSG MWKTPTERFF LWIGGFRPSE VLKNLRPQLE  300
PLTDKQVVEV GGLQQTSMQV EDALSQGMDK LKQTIADSLT AADPFDSPEA YMVHMANAVE  360
QLRSLVQFVT QADHLRQQTL QEMHRILTTR QAARGLLALG DYFQRFRALS SLWAARPRDS  420
GIS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0737150.0AK073715.1 Oryza sativa Japonica Group cDNA clone:J033059P06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636712.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_015636711.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_015636710.10.0PREDICTED: transcription factor TGA4 isoform X1
SwissprotQ391621e-130TGA4_ARATH; Transcription factor TGA4
TrEMBLA0A0E0PEM30.0A0A0E0PEM3_ORYRU; Uncharacterized protein
STRINGLOC_Os04g54474.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35713877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-121TGACG motif-binding factor 4