PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI04G20200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 278aa    MW: 30802.3 Da    PI: 6.4017
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI04G20200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.15e-51101371128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrF P+deelv++yL kkv++++ +   ++ evd++  ePw+Lp  +k + +ewyfFs rd+kyatg+r+nratk+gyWkatgkd+ev s
  ORUFI04G20200.1  10 LPPGFRFYPSDEELVCHYLYKKVSNERASQ-GTLVEVDLHAREPWELPDVAKLTASEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDREVRS 102
                      79*************************888.88***************77777889************************************** PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                        ++++vg++ktLvfy+grap+g+k+ Wvmhe+rl
  ORUFI04G20200.1 103 PaTRAVVGMRKTLVFYQGRAPNGVKSGWVMHEFRL 137
                      977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-608156IPR003441NAC domain
PROSITE profilePS5100558.73810156IPR003441NAC domain
PfamPF023654.3E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGLREIESTL PPGFRFYPSD EELVCHYLYK KVSNERASQG TLVEVDLHAR EPWELPDVAK  60
LTASEWYFFS FRDRKYATGS RTNRATKTGY WKATGKDREV RSPATRAVVG MRKTLVFYQG  120
RAPNGVKSGW VMHEFRLDSP HSPPKEDWVL CRVFQKSKGD GEQDNPTSAA SPAATFAGSS  180
QAAVPGQAAY SSDDHTGSSM GFAPRQNEIL DSSSHQLLNL AMLQCNSVLD HFPQEVNSSP  240
MMGLAGSIGI GDEYGFFYDT GFEETASLGG MRFPQGWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5011564165NO APICAL MERISTEM PROTEIN
1ut4_B2e-5011564165NO APICAL MERISTEM PROTEIN
1ut7_A2e-5011564165NO APICAL MERISTEM PROTEIN
1ut7_B2e-5011564165NO APICAL MERISTEM PROTEIN
3swm_A2e-5011567168NAC domain-containing protein 19
3swm_B2e-5011567168NAC domain-containing protein 19
3swm_C2e-5011567168NAC domain-containing protein 19
3swm_D2e-5011567168NAC domain-containing protein 19
3swp_A2e-5011567168NAC domain-containing protein 19
3swp_B2e-5011567168NAC domain-containing protein 19
3swp_C2e-5011567168NAC domain-containing protein 19
3swp_D2e-5011567168NAC domain-containing protein 19
4dul_A2e-5011564165NAC domain-containing protein 19
4dul_B2e-5011564165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:12787253, ECO:0000269|PubMed:14617069, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17056621, ECO:0000269|PubMed:17287247}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0629550.0AK062955.1 Oryza sativa Japonica Group cDNA clone:001-109-C12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634235.10.0protein CUP-SHAPED COTYLEDON 1
SwissprotQ9FRV48e-63NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBLA0A0D9ZN590.0A0A0D9ZN59_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GXN10.0A0A0E0GXN1_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PBK50.0A0A0E0PBK5_ORYRU; Uncharacterized protein
TrEMBLA2XVI60.0A2XVI6_ORYSI; Uncharacterized protein
TrEMBLQ7X7J40.0Q7X7J4_ORYSJ; NAC transcription factor
STRINGOGLUM04G18750.10.0(Oryza glumipatula)
STRINGORUFI04G20200.10.0(Oryza rufipogon)
STRINGOS04T0515900-010.0(Oryza sativa)
STRINGONIVA04G01950.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.16e-82NAC domain containing protein 74
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Shinohara N,Ohbayashi I,Sugiyama M
    Involvement of rRNA biosynthesis in the regulation of CUC1 gene expression and pre-meristematic cell mound formation during shoot regeneration.
    Front Plant Sci, 2014. 5: p. 159
    [PMID:24808900]
  3. Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M
    The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development.
    Front Plant Sci, 2014. 5: p. 165
    [PMID:24817871]
  4. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  5. Cui X, et al.
    REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis.
    Nat. Genet., 2016. 48(6): p. 694-9
    [PMID:27111035]
  6. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  7. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  8. González-Carranza ZH, et al.
    HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression.
    PLoS ONE, 2017. 12(9): p. e0185106
    [PMID:28934292]