PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI04G15090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 833aa    MW: 91637.8 Da    PI: 7.1165
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI04G15090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1609.5e-50101351125
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeel+ +yLkkkv  +k++l evi+evd++k+ePwdL++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk 
  ORUFI04G15090.1  10 VPPGFRFHPTDEELLLYYLKKKVGFEKFDL-EVIREVDLNKIEPWDLQErcRIGSaPQNEWYFFSHKDRKYPTGSRTNRATTAGFWKATGRDKC 102
                      69****************************.99**************963433332566*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmhe 125
                      + + + +++g++ktLvfy+grap+g+ktdW+mhe
  ORUFI04G15090.1 103 IRT-SYRKIGMRKTLVFYRGRAPHGQKTDWIMHE 135
                      **9.8999*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-505135IPR003441NAC domain
PROSITE profilePS5100546.49510170IPR003441NAC domain
PfamPF023651.3E-2411135IPR003441NAC domain
PfamPF085835.7E-8360411IPR013892Cytochrome c oxidase biogenesis protein Cmc1-like
Gene3DG3DSA:3.20.20.703.9E-126456825IPR013785Aldolase-type TIM barrel
CDDcd029333.33E-166462803No hitNo description
SuperFamilySSF513957.89E-108462822No hitNo description
PfamPF007247.0E-77463799IPR001155NADH:flavin oxidoreductase/NADH oxidase, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0010181Molecular FunctionFMN binding
GO:0016491Molecular Functionoxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 833 aa     Download sequence    Send to blast
MAAFSSSNGV PPGFRFHPTD EELLLYYLKK KVGFEKFDLE VIREVDLNKI EPWDLQERCR  60
IGSAPQNEWY FFSHKDRKYP TGSRTNRATT AGFWKATGRD KCIRTSYRKI GMRKTLVFYR  120
GRAPHGQKTD WIMHEVFKKK CFFKIGGGGG GEGSGGSQGG DVGGGHLAVS PPLGGGHAMA  180
AASHYMHPHH QYHHHHHAAA ASPFYYTQMP PPPAAAPPHA AYSHHVQVQD LLTNHRPSAD  240
AGYDFSGLPA VDHHHHHPGL DVGSSDGGGG VAAGGGVAAG GADGDQAAAA AAGSTDQQQW  300
QAMDGFSNGG AGAAAAVQQQ LGAMSSGQRG GEMDLWGYGR LTFYIFGNAS PSNLTQASYI  360
IEAFQKCHVD HPVKKFFGEC TDLKIKLDQC FRQEKALKRK ANFEESKKFK EHTVGSPIAD  420
IDCKSCSRNK DNYVICPFKF QVNQDTRTSR GAGEREKMDP VPLFNPCEMG RFTFSHRIVL  480
APLTRARSYG NLPQSHAILY YSQRATKGGL LISEATGVSS DAPCTNTPGI WTKEQVEAWK  540
PVVDAVHAKG GIFFCQIWHV GRASDLEQEP ISSTDKPVEK NEDMDFPVPR RLAVEEIPDV  600
INHFRIAARN AIDAGFDGVE VHGAHGFLLE QFMKDGVNDR ADEYGGSLQN RCRFALEVID  660
AVSTEVGPDR VGFRISPYIS YYGCHDSDPD ALGVYMAREL DRRGVLYCSA VEPEMVAATT  720
VVDGETTTTT MSRRMMIPHR LHGMREAFRR GMFMVGGGYD RDAGNMAVAS GYADMVVFGR  780
LFLANPDLPR RFQLDAPLNK YDRATFYTHD PVVGYTDYPF LDDDREAMSD HTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1vji_A1e-156456822536912-oxophytodienoate reductase (OPR1)
2q3r_A1e-156456822536912-oxophytodienoate reductase 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0672180.0AK067218.1 Oryza sativa Japonica Group cDNA clone:J013098J23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0P9N60.0A0A0E0P9N6_ORYRU; Uncharacterized protein
STRINGORUFI04G15090.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92973046
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33280.16e-74NAC domain containing protein 15