PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI04G15040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 117aa    MW: 13443.8 Da    PI: 9.6557
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI04G15040.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.98.2e-261058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     rien   rqvtf+kRr g+lKKA+ELSvLCda++ vi+fs++gk+ye +
  ORUFI04G15040.1 10 RIENPVHRQVTFCKRRMGLLKKAKELSVLCDADIGVIVFSPHGKIYELA 58
                     8*********************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.27E-28175IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.24161IPR002100Transcription factor, MADS-box
CDDcd002658.67E-38271No hitNo description
PRINTSPR004041.1E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.5E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KAKELSVLCD ADIGVIVFSP HGKIYELATN  60
GNMEGLIERY KCNLPEAQVE STEQNIPMMQ LMSREIEMLK NKEGILKAAN DILQERK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A5e-16170169MEF2C
5f28_B5e-16170169MEF2C
5f28_C5e-16170169MEF2C
5f28_D5e-16170169MEF2C
6byy_A6e-16170169MEF2 CHIMERA
6byy_B6e-16170169MEF2 CHIMERA
6byy_C6e-16170169MEF2 CHIMERA
6byy_D6e-16170169MEF2 CHIMERA
6bz1_A6e-16170169MEF2 CHIMERA
6bz1_B6e-16170169MEF2 CHIMERA
6bz1_C6e-16170169MEF2 CHIMERA
6bz1_D6e-16170169MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126122e-97CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020194477.12e-52MADS-box transcription factor 26-like
RefseqXP_020194478.12e-52MADS-box transcription factor 26-like
SwissprotQ2QW553e-45MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLA0A0E0P9M72e-80A0A0E0P9M7_ORYRU; Uncharacterized protein
STRINGORUFI04G15040.13e-81(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.19e-41AGAMOUS-like 12