PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G38450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 842aa    MW: 90980.3 Da    PI: 6.8788
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G38450.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26038.72.8e-1273879247101
           DUF260  47 kalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                      ++lp +er +a++s++ eA  r++dPvyG++gvi++lq q++ ++ ela +++++
  ORUFI03G38450.1 738 EQLPVQERGRAADSMAAEAYRRVQDPVYGCAGVINRLQDQIRAAQCELAWTHAQI 792
                      688999********************************************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.630.101.4E-9296146No hitNo description
SuperFamilySSF531871.28E-62102140No hitNo description
SuperFamilySSF520253.53E-42147362No hitNo description
Gene3DG3DSA:3.50.30.301.1E-33180337No hitNo description
SuperFamilySSF531871.28E-62344603No hitNo description
Gene3DG3DSA:3.40.630.101.4E-92345607No hitNo description
CDDcd080225.22E-110358605No hitNo description
PfamPF043893.1E-15362570IPR007484Peptidase M28
SuperFamilySSF476722.75E-27604736IPR007365Transferrin receptor-like, dimerisation domain
Gene3DG3DSA:1.20.930.401.7E-16608738IPR007365Transferrin receptor-like, dimerisation domain
PfamPF042532.3E-19634735IPR007365Transferrin receptor-like, dimerisation domain
PfamPF031951.3E-9738788IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006508Biological Processproteolysis
GO:0009640Biological Processphotomorphogenesis
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0009910Biological Processnegative regulation of flower development
GO:0010080Biological Processregulation of floral meristem growth
GO:0010081Biological Processregulation of inflorescence meristem growth
GO:0010082Biological Processregulation of root meristem growth
GO:0010305Biological Processleaf vascular tissue pattern formation
GO:0004181Molecular Functionmetallocarboxypeptidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
MPALTRALRC ALLAARVALA REKARRAFAS HGEMLSQPAA ALARLPPASV RVLVGFGAAL  60
LVSLVVLHRR PAARGAAGGG GPAEYDPAAR FLALSEGANA TIAADLRALT AGPHLAGTGA  120
AAGAAARVLS GFRAAGLRTL TREYTPLLSY PGHASLALLR ADRTLLAHLS LDEPADVGRR  180
LVRPYHAYAP SGGAVAEAVF VNLGREEDYL TLERLGVSVR GRVAVAIRGG GYRGGVVRRA  240
AERSAAAVLI AGHADGGVER GTVILGGPGD PLTPGWAATA GAERLDFDHE DVKRRFPAIP  300
SMPVSGKTAS AIIRTLGGPA LPADWQTGVG LPVDVGGVGP GPTLVNFTYQ EDRKMGMIQD  360
IFAIIKGYEE PDRYVILGNH RDAWTYGAVD PNSGTSALLD IARRLGIMLQ SGWTPRRTII  420
LCSWDAEEFG MFSKISFICV PFISFLHFEG SFFQIGSTEW VEENLEDLQS KAVAYLNVDC  480
AVQGIGLFAG STPQLDNLLV DVTRQVKDPD VEGKTVHDTW NKMTGGINIE RLARTDSDFA  540
PFLHHAGIPC MDLYYGKEFP GYHTALDSYH WMEKHGDPLF LRHVAIVEIW GLLALRLADD  600
PVLPFDYQTY ASQLQEHANA FSSMMENSKW VHLLNRSIED LSDAGLEFLK EAKKLQDQNI  660
SDGYSLMRRR LLNDRLLLAE RSFLQADGLQ GRGWFKHLMY SPPEDYESKL SFFPGVADAI  720
SRSSNRSAKE QQAAVRHEQL PVQERGRAAD SMAAEAYRRV QDPVYGCAGV INRLQDQIRA  780
AQCELAWTHA QIAMHSAAAA HARTTLPPGQ RDGGGGGAPS TQQATTSAAW QLEDFASEFS  840
FP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2xei_A1e-969472021671GLUTAMATE CARBOXYPEPTIDASE 2
3bhx_A1e-969472021671Glutamate carboxypeptidase 2
3bi0_A1e-969472021671Glutamate carboxypeptidase 2
3bi1_A1e-969472021671Glutamate carboxypeptidase 2
3d7d_A1e-969472021671Glutamate carboxypeptidase 2
3d7f_A1e-969472021671Glutamate carboxypeptidase 2
3d7g_A1e-969472021671Glutamate carboxypeptidase 2
3d7h_A1e-969472021671Glutamate carboxypeptidase 2
3iww_A1e-969472021671Glutamate carboxypeptidase 2
3sjf_A1e-969472021671Glutamate carboxypeptidase 2
4jyw_A1e-969472021671Glutamate carboxypeptidase 2
4jz0_A1e-969472021671Glutamate carboxypeptidase 2
4lqg_A1e-969472021671Glutamate carboxypeptidase 2
4oc0_A1e-969472021671Glutamate carboxypeptidase 2
4oc1_A1e-969472021671Glutamate carboxypeptidase 2
4oc2_A1e-969472021671Glutamate carboxypeptidase 2
4oc3_A1e-969472021671Glutamate carboxypeptidase 2
4oc4_A1e-969472021671Glutamate carboxypeptidase 2
4oc5_A1e-969472021671Glutamate carboxypeptidase 2
5ely_A1e-96947208658Glutamate carboxypeptidase 2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the regular timing (plastochron) of lateral organs formation. May regulate the rate of leaf initiation and the duration of vegetative phase. Seems to be redundant to the function of PLASTOCHRON1 and PLASTOCHRON2, but to act in an independent pathway. May be required for the synthesis of small signaling molecules that have a role in regulating meristem function. Involved in plant hormone homeostasis. {ECO:0000269|PubMed:19228340}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4474030.0AB447403.1 Oryza sativa Japonica Group PLA3 mRNA for plastochron3, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025879781.10.0probable glutamate carboxypeptidase PLA3 isoform X1
SwissprotQ852M40.0PLAT3_ORYSJ; Probable glutamate carboxypeptidase PLA3
TrEMBLA0A0E0P2C30.0A0A0E0P2C3_ORYRU; Uncharacterized protein
STRINGORUFI03G38450.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP803867
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.16e-11LOB domain-containing protein 24
Publications ? help Back to Top
  1. Kawakatsu T, et al.
    PLASTOCHRON3/GOLIATH encodes a glutamate carboxypeptidase required for proper development in rice.
    Plant J., 2009. 58(6): p. 1028-40
    [PMID:19228340]