PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G24400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 157aa    MW: 17620.3 Da    PI: 8.6984
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G24400.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF36.94.8e-122311342
                     HHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
           SRF-TF 13 fskRrngilKKAeELSvLCdaevaviifss 42
                     f kR++ ++KKA+ELS+L +++++v+++++
  ORUFI03G24400.1  2 FKKRQKSLMKKASELSTLYGVDACVVMYAE 31
                     89**************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500668.886131IPR002100Transcription factor, MADS-box
PfamPF003191.6E-11231IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-14276IPR002100Transcription factor, MADS-box
CDDcd002661.30E-15257No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MFKKRQKSLM KKASELSTLY GVDACVVMYA EGEAQPMMVW PSVPEARRVI ERFRALPQKD  60
QYENTTNLEG FLKQRIANLQ DKVDKAKHEN DELETKLLLL NSLDGCLPSL VGLTVKQITS  120
LNSMVEERLK KLRGNGLLAT PVPTSNQDVA SATNIQD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0933120.0AC093312.7 Oryza sativa chromosome 3 BAC OSJNBa0095N06 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025879443.11e-111agamous-like MADS-box protein AGL80
TrEMBLA0A0E0NXE01e-112A0A0E0NXE0_ORYRU; Uncharacterized protein
STRINGORUFI03G24400.11e-113(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G27810.19e-17M-type_MADS family protein