PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G16510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 392aa    MW: 42146.5 Da    PI: 8.814
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G16510.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.94.7e-5491391128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+v+yL+++++++++++ ++i++vdiyk++PwdLp+k++ +++ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk+++s
  ORUFI03G16510.1   9 LPPGFRFHPTDEELIVHYLRNRAASSPCPV-SIIADVDIYKFDPWDLPSKANYGDREWYFFSPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHS 101
                      79****************************.89***************999999**************************************** PP

              NAM  95 k....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +    ++e vg+kk Lvfykgr pkg+kt+W+mheyrl
  ORUFI03G16510.1 102 SggaaTNESVGVKKALVFYKGRPPKGTKTNWIMHEYRL 139
                      977776777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.29E-645173IPR003441NAC domain
PROSITE profilePS5100561.8539173IPR003441NAC domain
PfamPF023652.0E-2710139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MVLSNPAMLP PGFRFHPTDE ELIVHYLRNR AASSPCPVSI IADVDIYKFD PWDLPSKANY  60
GDREWYFFSP RDRKYPNGIR PNRAAGSGYW KATGTDKPIH SSGGAATNES VGVKKALVFY  120
KGRPPKGTKT NWIMHEYRLA AADAHAANTY RPMKFRNTSM RLDDWVLCRI YKKSSHASPL  180
AVPPLSDHEQ DEPCALEENA PLYAPSSSSA ASMILQGAAA GAFPSLHAAA AATQRTAMQK  240
IPSISDLLNE YSLSQLFDDG GAAAAAPLQE MARQPDHHHH HQQQHALFGH PVMNHFIANN  300
SMVQLAHLDP SSSAAASTSA GAVVEPPAVT GKRKRSSDGG EPTIQALPPA AAAAKKPNGS  360
CVGATFQIGS ALQGSSLGLS HQMLLHSNMG MN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-73917717169NO APICAL MERISTEM PROTEIN
1ut4_B2e-73917717169NO APICAL MERISTEM PROTEIN
1ut7_A2e-73917717169NO APICAL MERISTEM PROTEIN
1ut7_B2e-73917717169NO APICAL MERISTEM PROTEIN
3swm_A2e-73917720172NAC domain-containing protein 19
3swm_B2e-73917720172NAC domain-containing protein 19
3swm_C2e-73917720172NAC domain-containing protein 19
3swm_D2e-73917720172NAC domain-containing protein 19
3swp_A2e-73917720172NAC domain-containing protein 19
3swp_B2e-73917720172NAC domain-containing protein 19
3swp_C2e-73917720172NAC domain-containing protein 19
3swp_D2e-73917720172NAC domain-containing protein 19
4dul_A2e-73917717169NAC domain-containing protein 19
4dul_B2e-73917717169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2435140.0AK243514.1 Oryza sativa Japonica Group cDNA, clone: J100075D15, full insert sequence.
GenBankJN9823130.0JN982313.1 Oryza sativa Japonica Group NAC transcription factor 58 (NAC58) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632401.10.0NAC transcription factor 47
SwissprotQ8H4S46e-87NAC10_ORYSJ; NAC domain-containing protein 10
TrEMBLA0A0D3FI050.0A0A0D3FI05_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0NUH50.0A0A0E0NUH5_ORYRU; Uncharacterized protein
STRINGORUFI03G16510.10.0(Oryza rufipogon)
STRINGOBART03G15960.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.15e-86NAC domain containing protein 47
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]