PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G15220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 173aa    MW: 19049.7 Da    PI: 5.8395
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G15220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.35.2e-112382362
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                     e +   rk +NR++A+rsR +K+++++ L+ ++++L  eN+a++  +    + +  +++e
  ORUFI03G15220.1 23 EERQRNRKRSNRLSAQRSRIKKQQYVDGLAVEAEQLRRENDAMRAGAGAVLQRCRLVEQE 82
                     444455888***********************************9887777777666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.1E-101871No hitNo description
SMARTSM003381.2E-112085IPR004827Basic-leucine zipper domain
PfamPF001707.5E-82271IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.6112366IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.73E-82575No hitNo description
PROSITE patternPS0003602943IPR004827Basic-leucine zipper domain
CDDcd147024.22E-133277No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MSVAPATEGS ARRSAAAAAE EEEERQRNRK RSNRLSAQRS RIKKQQYVDG LAVEAEQLRR  60
ENDAMRAGAG AVLQRCRLVE QENRVLAAHA RELCSALQLR ASQLRLLGEV AGVPLDVPDV  120
ADHLVQLYGG DLGMTPLSPP PLLPPLPPQI EMLYFQPDSV MDPVSMLQGY ENI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1347690.0AC134769.1 Genomic sequence for Oryza sativa, Nipponbare strain, clone OJ1145F05, from chromosome 3, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAK1099290.0AK109929.1 Oryza sativa Japonica Group cDNA clone:002-151-H09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631799.11e-120PREDICTED: ocs element-binding factor 1
TrEMBLA0A0E0NU141e-121A0A0E0NU14_ORYRU; Uncharacterized protein
STRINGLOC_Os03g19370.11e-120(Oryza sativa Japonica Group)
STRINGLOC_Os03g19375.11e-120(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125042837
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.12e-08basic leucine-zipper 44