PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G06720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 74aa    MW: 7902 Da    PI: 9.3793
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G06720.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP38.73.7e-123174245
              TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkds 45
                     a +k ++++ h kv+  + R+R+ +  aa +F+L +eLG+++d+
  ORUFI03G06720.1 31 AIRKPPSKDCHNKVDALGCRIRMHIIYAAHIFQLNRELGHKSDG 74
                     689***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS513698.9383774IPR017887Transcription factor TCP subgroup
PfamPF036341.8E-73774IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MTKVHGDGGG GAALDKQLVP NASNDNGTAL AIRKPPSKDC HNKVDALGCR IRMHIIYAAH  60
IFQLNRELGH KSDG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2104801e-97AC210480.2 Oryza glaberrima clone OG_BBa0067M08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629543.12e-25PREDICTED: transcription factor TCP21-like
SwissprotQ9FTA24e-16TCP21_ARATH; Transcription factor TCP21
TrEMBLA0A0E0NQX06e-49A0A0E0NQX0_ORYRU; Uncharacterized protein
STRINGBGIOSGA005319-PA3e-23(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3818033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.12e-17TCP family protein