PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G01930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 426aa    MW: 45185.3 Da    PI: 5.9584
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G01930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.51.6e-09277335563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr +r   NR +A rs +RK  +i+eLe+kv+ L++e + L  +l +++  +a l +++
  ORUFI03G01930.1 277 KRVKRVLANRQSAARSKERKMRYIAELEQKVQILQSEATNLSAQLTMMQRDSAGLATQN 335
                      999***************************************99999888887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-15273337IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599275338IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.26E-11277328No hitNo description
PfamPF001701.7E-8277335IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-10277334No hitNo description
CDDcd147032.70E-22278329No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MNGGIGDALM QPQHVQVMSS SLPMVASTFV AEPAAAANKP RAAGLPPTPP QVFAAQRAAA  60
AAGGDVCMEE SAQGGGGGLP PRKAHRRSSS DVPFGYLAGQ HQLLPPKVEA GWGHLGAGAG  120
GAAAADDLFN AYLNLEGLDG LNSSDDRHDE GDSRGSSIKT NGADSSENES EECADDTRGG  180
IRLWSADGGE RREGVKRNAA GEPATAPLAR HARSLSMDSL IGKFNFTAGT AAAAGNGVAL  240
GPNRFSLEFG SGEFTPSEMK KIMADEKLAE MALADPKRVK RVLANRQSAA RSKERKMRYI  300
AELEQKVQIL QSEATNLSAQ LTMMQRDSAG LATQNNELKF RLHAMEQQAQ LRDALNEALT  360
TEVQRLKLAT AELGDSCSSS SLAQQIQLNA QNQMFQLQQQ QATQIPFYQL QQSQQNGAAK  420
NNESKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1444260.0AC144426.1 Oryza sativa Japonica Group chromosome 3 clone OJA1015F07, complete sequence.
GenBankAC1044270.0AC104427.2 Oryza sativa Japonica Group chromosome 3 clone OJ1015F07, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627932.10.0PREDICTED: transcription factor RF2b-like
TrEMBLA0A0E0NP460.0A0A0E0NP46_ORYRU; Uncharacterized protein
TrEMBLQ8S5V50.0Q8S5V5_ORYSJ; BZIP family transcription factor, putative, expressed
STRINGLOC_Os03g03550.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.33e-87bZIP family protein