PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G01510.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 185aa    MW: 20765.1 Da    PI: 11.2429
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G01510.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.42.5e-3095145151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
  ORUFI03G01510.4  95 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS 145
                      79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.8E-4187146IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.59587147IPR002100Transcription factor, MADS-box
PROSITE patternPS00350089143IPR002100Transcription factor, MADS-box
CDDcd002651.73E-3789145No hitNo description
SuperFamilySSF554554.58E-2989151IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-3189109IPR002100Transcription factor, MADS-box
PfamPF003191.6E-2796143IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-31109124IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-31124145IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MTIKNGNATA RTPPVAVCLC LPLPRGGVAT TRTKGNGNTR RDQKGKPRRR GRGEKGEGVG  60
EKEERASSFG YGQTLQRLHH HSLPFLMVRG KTQMKRIENP TSRQVTFSKR RNGLLKKAFE  120
LSVLCDAEVA LIVFSPRGKL YEFASARKIR PEKTAKTIFP RVAIELPSKQ SHYFHKEISC  180
ETGKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A9e-1889145258Myocyte-specific enhancer factor 2A
3mu6_B9e-1889145258Myocyte-specific enhancer factor 2A
3mu6_C9e-1889145258Myocyte-specific enhancer factor 2A
3mu6_D9e-1889145258Myocyte-specific enhancer factor 2A
5f28_A1e-1787146160MEF2C
5f28_B1e-1787146160MEF2C
5f28_C1e-1787146160MEF2C
5f28_D1e-1787146160MEF2C
6byy_A1e-1787146160MEF2 CHIMERA
6byy_B1e-1787146160MEF2 CHIMERA
6byy_C1e-1787146160MEF2 CHIMERA
6byy_D1e-1787146160MEF2 CHIMERA
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5519151e-161AY551915.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS210 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0NNZ61e-133A0A0E0NNZ6_ORYRU; Uncharacterized protein
STRINGORUFI03G01510.21e-102(Oryza rufipogon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.13e-35AGAMOUS-like 20