PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G39260.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 607aa    MW: 66821.8 Da    PI: 4.4273
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G39260.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.92e-49161521128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkya.........tgkrknratksgyW 83 
                      l+pGfrFhPtdeelv++yL++++ g++l++ ++i+evd+y++ePwdLp  +++++++ +wyfF++ d+k +          g+r+nrat +gyW
  ORUFI02G39260.3  16 LAPGFRFHPTDEELVSYYLRRRILGRRLRI-DAIAEVDLYRLEPWDLPslSRIRSRDAQWYFFARLDRKVTgagaggrggPGNRTNRATPRGYW 108
                      579***************************.99***************5448999999***********99777777665567*********** PP

              NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      k+tgkd++v++ +g+lvg+kktLvf++grapkg++t+Wvmheyrl
  ORUFI02G39260.3 109 KTTGKDRDVHH-RGKLVGMKKTLVFHSGRAPKGQRTNWVMHEYRL 152
                      ***********.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5511170IPR003441NAC domain
PROSITE profilePS5100555.4816170IPR003441NAC domain
PfamPF023654.3E-2718152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MSQSPPDSSS AAAVPLAPGF RFHPTDEELV SYYLRRRILG RRLRIDAIAE VDLYRLEPWD  60
LPSLSRIRSR DAQWYFFARL DRKVTGAGAG GRGGPGNRTN RATPRGYWKT TGKDRDVHHR  120
GKLVGMKKTL VFHSGRAPKG QRTNWVMHEY RLLDADGTQD LHVVCRIFQK NGSGPQNGAQ  180
YGAPYLEEDW EEEDDAIENM PASGAFAEMA ATQEYQPEIT PVKAQGSNEE TNGGGYSCDV  240
FSLDEILQEP ENVCKNEEQN AIDDKFTIAE LSGYPRQDDG YVGENGPVNW IDPSNGDNTN  300
WPLRAYSTQN HVNGTLSADG FFDTVNGTNS YSGPSDNQNL YLQDDGLTSS HQVGDNMPFY  360
DASSNHKWVD GKDDYLNLND LLYPPAENQP LFDAGDDLMA YFDATEDDFK FDIMGTEDSN  420
SQLPDMSNFV QKDDNNNKFT LDGISNTALY GASSSGSHGN MYPDTAVPDM PMDDTVDKSF  480
GKRLASMLGS IPAPPAMASE FPPSTGKSVV PLSAVNPSSS IRVTAGIIQL GGITFTGSTE  540
HLQKNGDFNL LLSFTVEGDV STKSIGFEPD TQMSTTPMVL RSGMYLFFVS AMILMLSYKV  600
GLCIYSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4271526140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1021730.0AK102173.1 Oryza sativa Japonica Group cDNA clone:J033086I18, full insert sequence.
GenBankAY2244330.0AY224433.1 Oryza sativa (japonica cultivar-group) isolate 20620 NAC-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624689.10.0NAC domain-containing protein 78 isoform X1
TrEMBLA0A0E0NN070.0A0A0E0NN07_ORYRU; Uncharacterized protein
STRINGORUFI02G39260.30.0(Oryza rufipogon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-69NAC domain containing protein 2